KEGG   Mycobacterium avium 104: MAV_2934Help
Entry
MAV_2934          CDS       T00433                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mav  Mycobacterium avium 104
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAV_2934 (malQ)
Enzymes [BR:mav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MAV_2934 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2971114..2973285
Genome map
AA seq 723 aa AA seqDB search
MDESGQQDGGMTELAPSLIELARRYGIATDYEDWTGRRVRVPETTLTAVLAALGVAAGTE
QERNDALTAKLRAYWARRLPATIVGRTGEQIRFWAHVTHGDPAEVWVRLEDGTVRDGVEQ
VDNFTPPFDLDGRWVGEASFVLPTDLPLGYHRVWLRSGGSEASAALIVTPDWLGLPERLG
ARRAWGLAVQLYSVRSRQSWGVGDLTDLTDLAVWSAFRHGADYLLVNPLHAAGFSGPANR
MEPSPYLPTSRRFVNPIYLHVEAIPEFAELTKRSRVRRLRADVQTHAAGLDAVDRDSSWA
AKRTALQWLHQQPRSAGRQLCYAAFRDREGRALDDFATWCALAEEYGPDWHSWPETLQHP
DAPGVADFVEKHSEAVDFHRWLQWQLDEQLAAAQSQAIRAGMSLGIMHDLAVGVHPNGAD
AWALQDVMALGVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRSLIRAVLRHAGGV
RIDHIIGLFRLWWIPRGSAPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWV
RDYLLLRGLLGTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAADHVRL
RDSLGLLSRPVADELESDRADLAAWMAELRRVGLLADGETDSEQVILALYRYLGRTPSRL
LGVALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGRPVLLEDVFTDRRAAALAEAVRAA
IAP
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaatccgggcagcaagatggcggtatgacagaactcgcgccgtcgctgatcgaa
ctcgcccgcagatacggcatcgcgacggattacgaggactggaccggccgccgggtgcgg
gtgcccgagaccacccttacggcggtgctggccgcgctcggcgtggccgccggcaccgag
caggaacgcaacgacgcgctgaccgccaagttgcgcgcgtactgggcgcgccggttgccc
gcgaccatcgtcgggcggaccggcgagcagatccggttctgggcgcacgtcacccacggc
gatcccgccgaggtgtgggtgcggctggaggacggcaccgtgcgcgacggcgtcgaacag
gtcgacaacttcaccccgccgttcgacctggacggccgctgggtcggcgaggcgagcttc
gtgctgcccaccgacctgccgctcggctatcaccgggtgtggctgcgctcgggcggatcg
gaggccagcgccgcgctgatcgtcacgccggattggctcggcctgccggaacgcctgggc
gcccggcgcgcctggggcctggccgttcagctctacagcgtgcggtcccggcagtcctgg
ggcgtcggcgatctcaccgatctcaccgacctcgcggtgtggtcggccttccgtcacggc
gccgactatctgttggtcaatcccctgcacgcggccgggttctccggccccgccaaccgg
atggagccctcgccctacctgccgacctcgcggcgcttcgtcaatccgatttatcttcac
gtcgaggcgatcccggagttcgccgaactgaccaagcgcagccgggtccggcggctgcgc
gcggacgtgcaaacccacgctgccggcctggacgccgtcgaccgggacagctcctgggcg
gccaagcgcacggcgctgcagtggctgcaccaacagccccgctcggcgggccggcaactg
tgttacgccgccttccgcgaccgcgagggccgggcgctcgacgacttcgccacctggtgc
gcgctggccgaggaatacggcccggactggcattcctggcccgagacgctccagcacccg
gacgcccccggggtcgccgatttcgtcgaaaagcattcggaggcagtcgatttccatcgc
tggctgcagtggcagctggacgagcagctggccgccgcgcagtcccaggcgatccgggcc
gggatgtcgctgggcatcatgcacgacctggccgtcggtgtgcatcccaacggcgccgac
gcctgggcgctgcaggatgtgatggcgctgggggtgaccgccggcgcgccgccggacgag
ttcaaccagctcggccaggactggtcgcagccgccgtggcgaccggaccggctcgacgag
cacgagtaccgacccttccgctccctgatccgcgcggtgctgcgacatgccggcggggtg
cgcatcgaccacatcatcgggctgttccggctgtggtggatcccgcgcggcagcgccccg
accgagggcacctacgtgcgctacgaccacgaggccatgatcggcatcgtcgcgctggag
gcgcatcgggccggggcggtggtggtcggcgaggacctgggcacggtcgagccgtgggtg
cgcgactacctgttgttgcgcggcctgctggggacctcgatcctgtggttcgagttggac
cgcgacggtaacggcggcccgctgccggccgagcggtggcgggagtactgcctgtcctcg
gtcaccacccacgacctgccgccgaccgccggctatctggccgccgaccatgtccggctg
cgcgattcgctgggcctgctgtcccggccggtggccgacgagctggagtccgaccgcgcc
gacctggcggcgtggatggccgagctgcgccgggtggggctgctcgcggacggcgaaacc
gactcggagcaagtcattttggcgctctaccgctatctgggccggacgccgtcgcggctg
ctgggtgtggcgctgaccgacgccgtgggcgaccgccgcacccagaaccagcccggcacc
accgacgagtaccccaactggcgcgttccgctgaccggtccggacgggcggccggtgctg
ctggaagacgtgttcaccgatcgtcgggccgccgccctggccgaggcggtgcgcgccgcc
atcgcgccgtga

DBGET integrated database retrieval system