KEGG   Mycobacterium avium 104: MAV_3069Help
Entry
MAV_3069          CDS       T00433                                 

Definition
(GenBank) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mav  Mycobacterium avium 104
Pathway
mav00350  Tyrosine metabolism
mav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAV_3069
Enzymes [BR:mav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAV_3069
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAV_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 DUF531 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABK67164
UniProt: A0A0H2ZXR2
Position
3134081..3134833
Genome map
AA seq 250 aa AA seqDB search
MDLKRRIPLLRWSVWRMAAGVQNITTTGQIGDGREAAAVEYVLRNARAGDIDDVLATIDR
FAYQKSMLINVGDEKGLILDAAVRRADPDVALELGTYCGYGALRIARAAPGARVFSVELA
EANAANARRIWAHAGVADRVTCVVGTIGDGGRTLDVLANEHGFAAGTLDFVFLDHDKDAY
LADLKSIMDRGWLHPGSIVVADNIRWPGSPKYREYMHVQQGKRFDTVEHKTHAEYQTMLS
DLMLESEYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaagcgacggatacccctgctgcggtggtcggtctggcgcatggcggccggg
gtgcagaacatcaccaccaccggccagatcggtgacggacgggaagcggccgccgtcgag
tacgtgctgcgcaacgcgcgggccggcgacatcgacgacgtgctggccaccatcgacagg
ttcgcctaccagaaatcgatgctgatcaatgtcggcgacgagaaggggctgatcctcgac
gccgcggtgcgccgcgccgacccggacgtggcgctggagctgggcacctactgcggctac
ggcgcgttgcggatcgcccgggccgccccgggcgcccgggtgttctcggtcgaactggcc
gaggccaacgccgccaacgcccgccggatctgggcgcacgccggcgtcgccgaccgggtg
acctgcgtggtgggcaccatcggcgacggcgggcgcaccctggacgtcctggccaacgag
cacggattcgctgccggcacactggatttcgtgtttctcgatcacgacaaggacgcctac
ctggccgacctgaagagcatcatggaccggggctggctacatccgggctcgatcgtggtc
gccgacaacatccgctggccgggctcgccgaagtaccgcgagtacatgcatgtccagcag
ggcaagcggttcgacaccgtcgagcacaagacgcatgccgagtaccagaccatgctctcc
gacctgatgctggagtccgaatacctgggctga

DBGET integrated database retrieval system