KEGG   Mycobacterium avium 104: MAV_3069Help
Entry
MAV_3069          CDS       T00433                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mav  Mycobacterium avium 104
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAV_3069
Enzymes [BR:mav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAV_3069
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAV_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3134081..3134833
Genome map
AA seq 250 aa AA seqDB search
MDLKRRIPLLRWSVWRMAAGVQNITTTGQIGDGREAAAVEYVLRNARAGDIDDVLATIDR
FAYQKSMLINVGDEKGLILDAAVRRADPDVALELGTYCGYGALRIARAAPGARVFSVELA
EANAANARRIWAHAGVADRVTCVVGTIGDGGRTLDVLANEHGFAAGTLDFVFLDHDKDAY
LADLKSIMDRGWLHPGSIVVADNIRWPGSPKYREYMHVQQGKRFDTVEHKTHAEYQTMLS
DLMLESEYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaagcgacggatacccctgctgcggtggtcggtctggcgcatggcggccggg
gtgcagaacatcaccaccaccggccagatcggtgacggacgggaagcggccgccgtcgag
tacgtgctgcgcaacgcgcgggccggcgacatcgacgacgtgctggccaccatcgacagg
ttcgcctaccagaaatcgatgctgatcaatgtcggcgacgagaaggggctgatcctcgac
gccgcggtgcgccgcgccgacccggacgtggcgctggagctgggcacctactgcggctac
ggcgcgttgcggatcgcccgggccgccccgggcgcccgggtgttctcggtcgaactggcc
gaggccaacgccgccaacgcccgccggatctgggcgcacgccggcgtcgccgaccgggtg
acctgcgtggtgggcaccatcggcgacggcgggcgcaccctggacgtcctggccaacgag
cacggattcgctgccggcacactggatttcgtgtttctcgatcacgacaaggacgcctac
ctggccgacctgaagagcatcatggaccggggctggctacatccgggctcgatcgtggtc
gccgacaacatccgctggccgggctcgccgaagtaccgcgagtacatgcatgtccagcag
ggcaagcggttcgacaccgtcgagcacaagacgcatgccgagtaccagaccatgctctcc
gacctgatgctggagtccgaatacctgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system