KEGG   Mycobacterium avium 104: MAV_3173Help
Entry
MAV_3173          CDS       T00433                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mav  Mycobacterium avium 104
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAV_3173 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAV_3173 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAV_3173 (trpA)
Enzymes [BR:mav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAV_3173 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3267409..3268224)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSQASRLGPIFEACRDDDRAALIGYLPTGYPDVPTSVQAMVALVESGCDIVEVGVP
YSDPGMDGPTIARATEAALHGGVRVRDTLAAVEAISAAGGRAVVMTYWNPVLRYGVDAFA
RDLAAAGGYGLITPDLIPDEAGQWLAASERHGLDRIFLVAPSSTPQRLALTVEASRGFVY
AASTMGVTGARDAVSHAAPELVSRVREISDIPVGVGLGVRSREQAAQIGGYADGVIVGSA
LVSALGDGGLTALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcagagccaggcgagccggctggggccgatcttcgaggcgtgccgcgac
gacgatcgggcggcgctgatcggttacctgcccaccggctacccggacgtgccgacctcg
gtgcaggcgatggtggcgctggtcgaatcgggttgcgacatcgtcgaagtcggggtgccg
tactcggatccggggatggacggcccgaccatcgcccgggccaccgaggccgcgctgcac
ggcggcgtgcgggtgcgcgacacactggccgcggtcgaggcgatcagcgcggccggcggg
cgcgcggtggtgatgacctactggaacccggtgctgcgctacggggtcgacgcgttcgcc
cgcgacctggccgcggccggcggctacggcctgatcacgcccgacctcatccccgacgaa
gccgggcagtggctggcggcctccgagcggcacgggctggaccggattttcctggtggcg
ccgtcgtcgacgccgcagcggttggcgctgacggtcgaggcgtcgcgcggattcgtctat
gcggcttcgacgatgggcgtcaccggggcgcgcgacgcggtgtcgcatgccgcgccggag
ctggtgagcagggtcagggagatctcggacatacccgtcggggtcgggctcggggtgcgc
tcgcgcgagcaagccgcccagatcggcggctacgccgacggtgtcatcgtcgggtcggcg
ctggtgtcggcgctgggggacggaggtttgaccgcattgcgtgcgctgactgaagaactc
gccgccggtgttcggcagagggcggccgcctcgtga

DBGET integrated database retrieval system