KEGG   Mycobacterium avium 104: MAV_3174Help
Entry
MAV_3174          CDS       T00433                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mav  Mycobacterium avium 104
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAV_3174 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAV_3174 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAV_3174 (trpB)
Enzymes [BR:mav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAV_3174 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3268221..3269492)
Genome map
AA seq 423 aa AA seqDB search
MTVDISPRTRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTTAYEKE
RVNQDFLDTLDYLQANYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQA
LLAQRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGAT
VVSVQSGSKTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQ
IQAQAGRLPDAVVACIGGGSNAIGIFHPFIDDPGVRLVGFEAAGDGVETGRHAATFSGGS
PGAFQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLRETGRAEYRPITDAEAMDA
FRVLCRTEGIIPAIESAHAVAGALKLGPELGRGAIIVVNLSGRGDKDVETAAKWFGLLGS
SDR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtggacatctccccccggacccgtccggaccttccgcttccgagcgcagcgatc
gccgaacccacccgtcatgaacccgacgccggtgggcatttcggcgtgtacggcggccgt
tacgtcgcggaggcgctgatggccgtcatcgaagaggtcaccaccgcctacgagaaggag
cgcgtcaaccaggatttcctggacacgctggactatctgcaggcgaactacgccgggcgg
ccgtcgccgttgtacgaggccccgcggctgtccgagcaggccggcgcgcggatcttcctc
aagcgagaagacttgaaccacaccggttctcacaagatcaacaacgtgctcggtcaggcg
ttgctggcccagcggatgggcaagaagcgggtgatcgccgagaccggggccggccagcac
ggcgtggccaccgccacggcctgcgccctgctgggcctggaatgcgtgatctacatgggt
gcggtggacaccgagcgccaggcgctcaacgtggcgcggatgcgcctgctgggtgcgacg
gtcgtctcggtgcagagcggttcgaaaacgctcaaggacgccatcaacgaagccttccgg
gactgggtcaccaacgccgataacaccttctactgcttcggcaccgcggccgggccgcac
cccttcccggccatggtccgcgatttccagcgcatcatcgggctggaggcacgcgcccag
atccaggcgcaggcgggccggctgcccgacgcggtggtggcctgcatcggcggcggctcc
aacgccatcgggatcttccatccgttcatcgacgaccctggcgtgcggctggtgggattc
gaggcggccggtgacggcgtcgaaaccggaaggcacgccgcgactttcagcggcggctcg
cccggggcgttccaggggtcgttctcctacctgctgcaggacgaagacgggcagaccatc
gaatcccattccatctcagcgggtctcgactatcccggagtcggtccagaacatgcgtat
ctgcgcgagaccggccgtgccgaataccgtccgatcaccgacgccgaggcgatggacgcg
tttcgggtgctgtgccgcaccgaggggatcatcccggccatcgagtccgcgcacgccgtg
gcgggtgcgctgaagttggggcccgagctgggccgcggcgcgatcatcgtggtgaacctg
tccgggcgcggggacaaggacgtcgagacggcggcaaagtggttcgggctgttggggtcc
agcgaccgatga

DBGET integrated database retrieval system