KEGG   Mycobacterium avium 104: MAV_3174Help
Entry
MAV_3174          CDS       T00433                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mav  Mycobacterium avium 104
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAV_3174 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAV_3174 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAV_3174 (trpB)
Enzymes [BR:mav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAV_3174 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3268221..3269492)
Genome map
AA seq 423 aa AA seqDB search
MTVDISPRTRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTTAYEKE
RVNQDFLDTLDYLQANYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQA
LLAQRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGAT
VVSVQSGSKTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQ
IQAQAGRLPDAVVACIGGGSNAIGIFHPFIDDPGVRLVGFEAAGDGVETGRHAATFSGGS
PGAFQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLRETGRAEYRPITDAEAMDA
FRVLCRTEGIIPAIESAHAVAGALKLGPELGRGAIIVVNLSGRGDKDVETAAKWFGLLGS
SDR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtggacatctccccccggacccgtccggaccttccgcttccgagcgcagcgatc
gccgaacccacccgtcatgaacccgacgccggtgggcatttcggcgtgtacggcggccgt
tacgtcgcggaggcgctgatggccgtcatcgaagaggtcaccaccgcctacgagaaggag
cgcgtcaaccaggatttcctggacacgctggactatctgcaggcgaactacgccgggcgg
ccgtcgccgttgtacgaggccccgcggctgtccgagcaggccggcgcgcggatcttcctc
aagcgagaagacttgaaccacaccggttctcacaagatcaacaacgtgctcggtcaggcg
ttgctggcccagcggatgggcaagaagcgggtgatcgccgagaccggggccggccagcac
ggcgtggccaccgccacggcctgcgccctgctgggcctggaatgcgtgatctacatgggt
gcggtggacaccgagcgccaggcgctcaacgtggcgcggatgcgcctgctgggtgcgacg
gtcgtctcggtgcagagcggttcgaaaacgctcaaggacgccatcaacgaagccttccgg
gactgggtcaccaacgccgataacaccttctactgcttcggcaccgcggccgggccgcac
cccttcccggccatggtccgcgatttccagcgcatcatcgggctggaggcacgcgcccag
atccaggcgcaggcgggccggctgcccgacgcggtggtggcctgcatcggcggcggctcc
aacgccatcgggatcttccatccgttcatcgacgaccctggcgtgcggctggtgggattc
gaggcggccggtgacggcgtcgaaaccggaaggcacgccgcgactttcagcggcggctcg
cccggggcgttccaggggtcgttctcctacctgctgcaggacgaagacgggcagaccatc
gaatcccattccatctcagcgggtctcgactatcccggagtcggtccagaacatgcgtat
ctgcgcgagaccggccgtgccgaataccgtccgatcaccgacgccgaggcgatggacgcg
tttcgggtgctgtgccgcaccgaggggatcatcccggccatcgagtccgcgcacgccgtg
gcgggtgcgctgaagttggggcccgagctgggccgcggcgcgatcatcgtggtgaacctg
tccgggcgcggggacaaggacgtcgagacggcggcaaagtggttcgggctgttggggtcc
agcgaccgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system