KEGG   Mycobacterium avium 104: MAV_3294Help
Entry
MAV_3294          CDS       T00433                                 

Definition
enoyl-(acyl carrier protein) reductase (EC:1.3.1.10)
Orthology
K11611  
enoyl ACP reductase [EC:1.3.1.9]
Organism
mav  Mycobacterium avium 104
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3435190..3435999)
Genome map
AA seq 269 aa AA seqDB search
MAGLLDGKRILVTGIITDSSIAFHIAKVAQEAGAQLVLTGFDRLRLIQRIVDRLPEKAPL
IELDVQNEEHLNTLAQRVTAEIGEGNKLDGVVHSIGFMPQTGMGINPFFDAPYEDVSKGI
HISAYSYASLAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
PHGVRSNLVAAGPIRTLAMAGIVGGVLGDQAAEQIRLLEEGWDQRAPIGWNMKDPTPVAK
TVCALLSDWLPATTGTIIYADGGASTQLL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactgctcgacggcaaacggatcctggtcaccgggatcatcaccgactcgtcg
atcgcgtttcacatcgccaaggtggcccaggaggccggggcgcagttggtgctgaccggc
ttcgaccggctgcggctgatccagcgcatcgtcgaccggctgccggagaaggccccgttg
atcgagctcgacgtgcagaacgaggagcacctgaacaccctggcccagcgggtgaccgcc
gagatcggcgagggcaacaagctcgacggggtggtgcactcgatcggcttcatgccgcag
accggcatgggcatcaacccgttcttcgacgcgccgtacgaggatgtctccaaaggcatt
cacatctcggcgtattcgtacgcctcgctggccaaggcgctgctgccgatcatgaacccc
ggcgggtcgatcgtgggcatggacttcgaccccagccgggcgatgccggcctacaactgg
atgacggtcgcgaagagcgcgctggagtcggtcaaccggttcgtggcgcgcgaggccggg
ccgcacggcgtgcgctcgaatctcgttgcggcgggcccgatccgcacgctggcgatggcc
gggatcgtcggcggcgtgctcggcgaccaggcggccgagcagatccggctgctggaggag
ggctgggatcagcgggccccgatcggctggaacatgaaggaccccaccccggtggccaag
acggtgtgcgcgctgctgtccgactggctgccggccaccaccggcaccatcatctacgcc
gacggcggcgccagcacccaattgctgtag

DBGET integrated database retrieval system