KEGG   Mycobacterium avium 104: MAV_3339Help
Entry
MAV_3339          CDS       T00433                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_3339 (tpiA)
   01230 Biosynthesis of amino acids
    MAV_3339 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_3339 (tpiA)
   00051 Fructose and mannose metabolism
    MAV_3339 (tpiA)
   00562 Inositol phosphate metabolism
    MAV_3339 (tpiA)
Enzymes [BR:mav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAV_3339 (tpiA)
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAV_3339 (tpiA)
  Exosomal proteins of bladder cancer cells
   MAV_3339 (tpiA)
  Exosomal proteins of melanoma cells
   MAV_3339 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3482276..3483061)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLSYGAQDLSQHDSGAYTGDISGAFLAKLGCTFVVVGHSERRTYHNEDDALVAAKAAA
ALKHELTPIICIGEHLEVREAGNHVIHCEEQLRGSLAGLSAEQIGKVVIAYEPVWAIGTG
RVASASDAQEVCAAIRKELASLASAQIADSVRVLYGGSVNAKNVGELIAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtggac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctcagctacggcgcccaggacctatcccagcacgactcgggcgcctacacc
ggcgacatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcggcgcacctaccacaacgaggacgatgcgctggtggccgccaaggccgcggcc
gcgctcaagcacgagctgaccccgatcatctgcatcggcgagcacctcgaggtccgcgag
gcgggcaaccacgtcatccactgcgaggagcagctgcgcggctcgctggccgggctgtcc
gccgagcagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgattggaaccgga
cgggtggccagtgcgtccgatgctcaagaggtgtgcgcggcgatccggaaagagttggcg
tcactcgcctcggcgcagatcgccgactcggtgcgggtgctctacggcggctcggtgaac
gcgaagaacgtcggggagttgatcgcccaggacgacatcgacggcggcctggtgggcggc
gcgtcgctggacggcgagcagttcgccaccctggccgccatcgccgccggcgggccgctg
ccgtga

DBGET integrated database retrieval system