KEGG   Mycobacterium avium 104: MAV_3452Help
Entry
MAV_3452          CDS       T00433                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mav  Mycobacterium avium 104
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MAV_3452
Enzymes [BR:mav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MAV_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3597534..3598331)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSELMRRAAEQLTALQGRDAAESPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAEADGTYYTQRLGLGFDEITDGNLLLVDEDLNVLEGDGMANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIITAALGDK
KAVLLAHHGHVIAGASIEEACSLGILIERAAKLQLAAMAAGTVKQLPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatcggaattgatgcgccgggctgccgagcagttg
acggcgttgcagggccgggacgccgccgaatcgccgttgaccacccgccagaagctggcc
ctgacctgccgggcgctgttcgacgccgggcacgactccgggctggccgggcagatcacc
gcccgcgccgaggccgacggcacctactacacccagcggctcggcctgggcttcgacgag
atcaccgacggcaatctgctgctggtcgacgaggacctcaatgtcctcgagggtgacgga
atggccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgacgtgcag
tgcatcgtgcacacccatgcgttccacgtggcggcgctgtccatgctggaggtcccgctg
gtggtatctcacatggacaccaccccgctgtacgacgactgcgcgtttctggccgactgg
ccgggcgtgcccgtcggcaacgaggagggggagatcatcaccgccgcgctgggcgacaag
aaggcggtgctgctggcccaccacggccacgtcatcgccggcgccagcatcgaggaggcg
tgctcgttgggaatcctcatcgagcgcgccgccaagctgcagctggccgcgatggccgcc
ggcaccgtcaagcagctgcccgaggagctggcccgcgaggcccacgactggacgctgtcg
ccgcagcgcagccgggccaacttcgcctactacgcccgccgggccctggcccgccatccc
gacgcgctgaccagctga

DBGET integrated database retrieval system