KEGG   Mycobacterium avium 104: MAV_3452Help
Entry
MAV_3452          CDS       T00433                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mav  Mycobacterium avium 104
Pathway
mav00051  Fructose and mannose metabolism
mav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MAV_3452
Enzymes [BR:mav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MAV_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABK68048
UniProt: A0A0H2ZZ68
Position
complement(3597534..3598331)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSELMRRAAEQLTALQGRDAAESPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAEADGTYYTQRLGLGFDEITDGNLLLVDEDLNVLEGDGMANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIITAALGDK
KAVLLAHHGHVIAGASIEEACSLGILIERAAKLQLAAMAAGTVKQLPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatcggaattgatgcgccgggctgccgagcagttg
acggcgttgcagggccgggacgccgccgaatcgccgttgaccacccgccagaagctggcc
ctgacctgccgggcgctgttcgacgccgggcacgactccgggctggccgggcagatcacc
gcccgcgccgaggccgacggcacctactacacccagcggctcggcctgggcttcgacgag
atcaccgacggcaatctgctgctggtcgacgaggacctcaatgtcctcgagggtgacgga
atggccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgacgtgcag
tgcatcgtgcacacccatgcgttccacgtggcggcgctgtccatgctggaggtcccgctg
gtggtatctcacatggacaccaccccgctgtacgacgactgcgcgtttctggccgactgg
ccgggcgtgcccgtcggcaacgaggagggggagatcatcaccgccgcgctgggcgacaag
aaggcggtgctgctggcccaccacggccacgtcatcgccggcgccagcatcgaggaggcg
tgctcgttgggaatcctcatcgagcgcgccgccaagctgcagctggccgcgatggccgcc
ggcaccgtcaagcagctgcccgaggagctggcccgcgaggcccacgactggacgctgtcg
ccgcagcgcagccgggccaacttcgcctactacgcccgccgggccctggcccgccatccc
gacgcgctgaccagctga

DBGET integrated database retrieval system