KEGG   Mycobacterium avium 104: MAV_3633Help
Entry
MAV_3633          CDS       T00433                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mav  Mycobacterium avium 104
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mav00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3761288..3761719
Genome map
AA seq 143 aa AA seqDB search
MTELTGTTVANTRTVEGFLNALQDADYDAAEAALADDLVYENVGLPTIHGRARAMKLFRR
MEGRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWVCGVFEVQNGRITLWRDYFDF
FDMLKATARGVAALLLPSLKATF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgactgggaccaccgttgcgaacacccgtacggtcgaaggattcctcaac
gcgctgcaggacgcggattacgacgccgccgaggccgcgctggccgacgacctcgtctac
gagaacgtcgggctgcccaccatccacggccgggcccgagccatgaagctgtttcgccgg
atggagggccgcgccgccttcgaggtgaagatccaccgcatcgcggccgacggcggcgcg
gtgctcaccgaacgcaccgatgcgctgatcttcggcccgctgcggctgcagttctgggtg
tgcggcgtgttcgaggtgcagaacgggcgaatcacgttgtggcgggactacttcgacttc
ttcgacatgctcaaggccacggcgcgcggggtggccgcgctgctgctgccgtcgctgaaa
gccacgttctga

DBGET integrated database retrieval system