KEGG   Mycobacterium avium 104: MAV_3706Help
Entry
MAV_3706          CDS       T00433                                 

Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAV_3706
Enzymes [BR:mav01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MAV_3706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3833002..3834843)
Genome map
AA seq 613 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSAATGSDA
NLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDVL
LDAAAMGRVHIERDGISHSHDARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVEVR
AQVIRQRMAYEADPDGFAERYADADAELARRIAAARALVDDVVLPDNELRRIAALCAAFD
VDGMRADLVVARTAVAHAAWRGAPTVEEQDIRVAAELALPHRRRRDPFDDPGIDREQLDE
ALAQAGSEPDPDPDPPGGGQAGQTEQQPPQRDSAQDAKPRPPTTKPSAPPSKTFRTRALR
VPGVGEGAPGRRSRARNASGSVIAATDGADTGCGGHGLHLFATLLSAAERAGAGPLRPGP
DDVRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRQ
QQARLLLPPTSSAHIAGRRLARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLT
DGRATAGPDPLGRSRIAAARLVAEGAAAVVVDCETSYVRLGLAEHLARQLGAPAVRLEQL
HADSLTRAVRDAA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccctacccgttcagcgccatcgtcgggcacgaccggctgcggctggccctgctg
ctgtgcgccgtgcgcccggagatcggcggcgcgctcatccgcggcgagaagggcaccgcc
aagtcgacggccgtgcgcggcctggcggccctgctgtccgccgccaccggcagcgacgcg
aacctggtcgaaatgccgctcggcgcaaccgaagaccgggtgatcggctcgctggacctg
cagcgggtgctgcgcgacggcgagcacgcgttctccccggggctgctggcccgcgcgcac
ggcggtgtgctctacgtcgacgaggtgaacctgctgcacgatcatctcgtcgacgtgttg
ctcgacgccgcggcgatgggacgggtgcacatcgaacgcgacggcatctcgcattcgcac
gacgcccggttcgtgttgatcggcaccatgaatcccgaagagggcgaactgcgtccgcag
ctgctggaccggttcgggctcaccgtcgacgtgcatgcctcgcgtgacgtggaggtgcgg
gcgcaggtgatccggcagcggatggcctatgaggccgacccggacggtttcgccgaacgc
tacgccgacgccgacgccgagctggcccggcgcatcgctgcggcgcgcgccctggtcgac
gacgtggtgttgcccgacaacgagttacggcgcatcgcggcgctgtgcgcggcgttcgac
gtggacggcatgcgggccgatctggtggtggcccgcaccgcggtcgcgcacgcggcctgg
cgcggcgcgcccaccgtcgaggagcaggacatccgggtggccgccgagctggccctgccg
caccgccgccgccgcgatcccttcgacgacccgggcatcgaccgcgagcaactggacgag
gccctggcccaggccggctccgagcccgacccggatcccgacccgcccggaggaggccag
gccggccagaccgaacagcaaccgccgcaacgggattcggcgcaggacgccaagccgcgg
ccgccgacgacgaaaccgagtgcgccgccgtcgaagacgtttcgcacccgcgcgctgcgg
gtccccggtgtcggcgaaggggcacccggccggcggtcgcgggcccgcaacgccagcggc
agcgtcatcgcagccaccgacggcgccgacaccggctgcggcggccacgggctgcacctg
ttcgccaccctgctctcggccgccgaacgggccggtgccgggccgctgcggccggggccc
gacgatgtgcgacgggccgtgcgcgagggccgcgaaggcaatctggtgatcttcgtcgtc
gacgcctccggatcgatggcggcgcgggaccggatggcggcggtcagcggtgccacgctg
tcgctgctgcgcgacgcctatcagcgccgcgacaaggtcgccgtgatcacgttccggcaa
cagcaggcgcggctgctgttgccgcccacctcctcggcgcacatcgccgggcggcggctg
gcccgcttcgacaccggcggcaagacgccgctggccgaagggctgctggccgcgcgcgag
ctgatcgtccgggagaaggcccgcgaccgggcgcgccgcgccctcgtggtggtgctcacc
gacggccgggccaccgccggcccggatccgttgggccgcagccggatcgccgcggcccgg
ctggtcgccgagggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtgcgtctg
ggcctggccgaacacctggcacgccagctgggcgccccggcggtgcggctggagcagttg
cacgcggattcgctgacgcgtgcggtgcgcgacgccgcctga

DBGET integrated database retrieval system