KEGG   Mycobacterium avium 104: MAV_3937Help
Entry
MAV_3937          CDS       T00433                                 

Gene name
ligB
Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mav03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mav03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mav03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:mav03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4064305..4065885
Genome map
AA seq 526 aa AA seqDB search
MSPSHAKLATVLLFDVATASADVGGTPSRLTKVARIADLLRRAAPDAALVAIVVSWLSGE
LRQRQIGVGWAALRSRPPAAAHPTLTVVAVDAAFAEIGAVAGKGAQARRAALLNALFAAA
TETEQTFLLRLLGGELRQGALAGIMADAVARAAGIPAAAVQRAAMLGGDLPAVAAAALSG
EAAALSGEASALDAFTLRVGRPVAPMLAQTAAGVAEAIERHGGQAIFEAKLDGARVQIHR
AGDQVTVYTRSLDDVTARLPEVVTATLALPVEALIADGEAIALRPDNSPQRFQVTASRFG
RSVDVAAAVAAQPLSVFFFDILHCDGVDLLDAPTTDRLAALDALVPPAQRVDQLLTADPD
AAGRFLEATLAAGHEGVMAKAPGAPYQAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRG
KLSNIHLGARDPATGEFVMVGKTFKGMTDAMLDWQTARFTELAVGGTDGYVVRVRPEQVV
EVAVDGVQKSSRYPGGLALRFARVLRYRDDKGPAEADTIDAVRALY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccgagccatgccaagctggcgaccgtgctgcttttcgacgtggcgacggcgtcg
gccgacgtcgggggcacgccgtcgcggctgaccaaagtcgcccgcatcgccgacctgctg
cgccgggccgcacccgacgccgccctggtcgcgatcgtcgtgtcgtggctgtccggtgag
ttgcggcagcgccagatcggggtcggctgggcggcgttgcgctcgcgcccgcccgcggcc
gcacatcccacgctgaccgttgtcgcggtggacgccgccttcgccgagatcggcgccgtg
gcgggcaagggcgcccaggcgcgccgcgcggccctgctgaacgcgttgttcgccgcggcc
accgagaccgagcagacgtttctgctgcggctgctgggcggcgaactgcgccagggcgcg
ctggccgggatcatggccgacgccgtcgccagggccgccgggataccggccgccgcggtg
cagcgcgccgcgatgctgggcggtgacctgccggcggtggcggcggccgcgctgtccggg
gaggcggccgcgctgtccggtgaggcgtccgcgctggacgccttcacgctgcgggtgggc
cggccggtcgcgccgatgctggcccagaccgcggcgggtgtggccgaggcgatcgaacgc
cacggcgggcaggcgattttcgaggccaagctggacggggcgcgggtgcagatccaccgc
gccggcgaccaggtcaccgtctacacccgaagcctcgacgacgtcaccgcccggctgccc
gaggtggtgaccgcgacgctggcgctgccggtcgaggccctgatcgccgacggtgaggcg
atcgcgctgcggccggacaactcaccgcagcgcttccaggtcaccgcctcacgcttcggc
cgctcggtagatgtcgcggcagccgttgcggcgcaaccactttcggtgttcttcttcgac
atcctgcactgcgacggcgtcgacctgctggacgcgccgaccaccgaccggctggccgcg
ctggacgccctggtgccgcccgcgcagcgggtcgaccagctgctcaccgccgaccccgac
gcggcgggccggttcctggaggcgacgctggccgccgggcacgagggcgtgatggccaag
gcgccgggcgcgccctatcaggcgggccggcgcggggcgggctggctcaaggtcaagccg
gtgcacacgctggatctggtggtgctcgccgtggagtggggctcggggcggcgccgcggc
aagctgtccaacatccacctgggcgcccgcgacccggccaccggcgaattcgtcatggtg
ggaaagactttcaagggcatgaccgacgcgatgctggactggcagacggcccggttcacc
gagctggccgtcggcggcacggacggctacgtggtgcgggtgcgacccgagcaggtggtc
gaggtggcggtggacggtgtgcagaaatcctcgcgctaccccggcgggctggcgctgcgg
ttcgccagggtgctgcgctaccgcgacgacaagggacccgccgaggccgacaccatcgac
gccgtccgcgcgctgtactga

DBGET integrated database retrieval system