KEGG   Mycobacterium avium 104: MAV_3937Help
Entry
MAV_3937          CDS       T00433                                 

Gene name
ligB
Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mav00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MAV_3937 (ligB)
   03420 Nucleotide excision repair
    MAV_3937 (ligB)
   03430 Mismatch repair
    MAV_3937 (ligB)
   03450 Non-homologous end-joining
    MAV_3937 (ligB)
Enzymes [BR:mav01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAV_3937 (ligB)
DNA repair and recombination proteins [BR:mav03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MAV_3937 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4064305..4065885
Genome map
AA seq 526 aa AA seqDB search
MSPSHAKLATVLLFDVATASADVGGTPSRLTKVARIADLLRRAAPDAALVAIVVSWLSGE
LRQRQIGVGWAALRSRPPAAAHPTLTVVAVDAAFAEIGAVAGKGAQARRAALLNALFAAA
TETEQTFLLRLLGGELRQGALAGIMADAVARAAGIPAAAVQRAAMLGGDLPAVAAAALSG
EAAALSGEASALDAFTLRVGRPVAPMLAQTAAGVAEAIERHGGQAIFEAKLDGARVQIHR
AGDQVTVYTRSLDDVTARLPEVVTATLALPVEALIADGEAIALRPDNSPQRFQVTASRFG
RSVDVAAAVAAQPLSVFFFDILHCDGVDLLDAPTTDRLAALDALVPPAQRVDQLLTADPD
AAGRFLEATLAAGHEGVMAKAPGAPYQAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRG
KLSNIHLGARDPATGEFVMVGKTFKGMTDAMLDWQTARFTELAVGGTDGYVVRVRPEQVV
EVAVDGVQKSSRYPGGLALRFARVLRYRDDKGPAEADTIDAVRALY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccgagccatgccaagctggcgaccgtgctgcttttcgacgtggcgacggcgtcg
gccgacgtcgggggcacgccgtcgcggctgaccaaagtcgcccgcatcgccgacctgctg
cgccgggccgcacccgacgccgccctggtcgcgatcgtcgtgtcgtggctgtccggtgag
ttgcggcagcgccagatcggggtcggctgggcggcgttgcgctcgcgcccgcccgcggcc
gcacatcccacgctgaccgttgtcgcggtggacgccgccttcgccgagatcggcgccgtg
gcgggcaagggcgcccaggcgcgccgcgcggccctgctgaacgcgttgttcgccgcggcc
accgagaccgagcagacgtttctgctgcggctgctgggcggcgaactgcgccagggcgcg
ctggccgggatcatggccgacgccgtcgccagggccgccgggataccggccgccgcggtg
cagcgcgccgcgatgctgggcggtgacctgccggcggtggcggcggccgcgctgtccggg
gaggcggccgcgctgtccggtgaggcgtccgcgctggacgccttcacgctgcgggtgggc
cggccggtcgcgccgatgctggcccagaccgcggcgggtgtggccgaggcgatcgaacgc
cacggcgggcaggcgattttcgaggccaagctggacggggcgcgggtgcagatccaccgc
gccggcgaccaggtcaccgtctacacccgaagcctcgacgacgtcaccgcccggctgccc
gaggtggtgaccgcgacgctggcgctgccggtcgaggccctgatcgccgacggtgaggcg
atcgcgctgcggccggacaactcaccgcagcgcttccaggtcaccgcctcacgcttcggc
cgctcggtagatgtcgcggcagccgttgcggcgcaaccactttcggtgttcttcttcgac
atcctgcactgcgacggcgtcgacctgctggacgcgccgaccaccgaccggctggccgcg
ctggacgccctggtgccgcccgcgcagcgggtcgaccagctgctcaccgccgaccccgac
gcggcgggccggttcctggaggcgacgctggccgccgggcacgagggcgtgatggccaag
gcgccgggcgcgccctatcaggcgggccggcgcggggcgggctggctcaaggtcaagccg
gtgcacacgctggatctggtggtgctcgccgtggagtggggctcggggcggcgccgcggc
aagctgtccaacatccacctgggcgcccgcgacccggccaccggcgaattcgtcatggtg
ggaaagactttcaagggcatgaccgacgcgatgctggactggcagacggcccggttcacc
gagctggccgtcggcggcacggacggctacgtggtgcgggtgcgacccgagcaggtggtc
gaggtggcggtggacggtgtgcagaaatcctcgcgctaccccggcgggctggcgctgcgg
ttcgccagggtgctgcgctaccgcgacgacaagggacccgccgaggccgacaccatcgac
gccgtccgcgcgctgtactga

DBGET integrated database retrieval system