KEGG   Mycobacterium avium 104: MAV_4066Help
Entry
MAV_4066          CDS       T00433                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mav  Mycobacterium avium 104
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mav00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAV_4066 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MAV_4066 (cheB)
Enzymes [BR:mav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MAV_4066 (cheB)
Two-component system [BR:mav02022]
 CheA family
  CheA-CheYBV
   MAV_4066 (cheB)
Bacterial motility proteins [BR:mav02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MAV_4066 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4186462..4187379
Genome map
AA seq 305 aa AA seqDB search
METERVTTEADRPGVELVALVASAGGLEALTTVLRDLPRDFPAAVVVQQHLAGHDSLLAT
ILTRQSGRPVGWAANGRAVTPGEVVICPPGKALELTPQGRWRLHGAQQHGARGADVLLTS
IAGSYGPRGVAVVLSGSGRDGAAGTVAMRRAGGVVIAESPATALYPSMPIAAAQAGADLV
LGIGEIAPVLADLVHGLPLPRRSPPADAPDEAHLDGGVDPDGIFARLAARFGANTPAARA
ELARLRAAELRRRRQELSAGVGATRETVATAQRRAEESRRRALLAHRAADEAWARSEQEH
RDRDG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggagactgaacgggtgacgactgaggcggatcggcccggagtcgagctggtggcgctg
gtggcgtcggcgggcggcttggaggcgctgaccaccgtgctgcgggatctgccgcgcgat
tttcccgccgccgtcgtcgtccagcagcacctggccggtcatgacagcctgctggccacc
atcctgacccggcaatcggggcggccggtcggctgggcggccaacgggcgagccgtcacg
cccggggaggtggtcatctgtccgccgggcaaggcgctggagctgacgccgcagggccgc
tggcggctgcacggcgcacagcagcacggggcgcggggcgccgacgtgttgttgacctcg
atcgccggctcctacggaccgcgaggcgtcgccgtcgtgctgtcggggtccgggcgcgac
ggcgcggcgggcaccgtcgcgatgcgccgggccggcggcgtggtgatcgccgagagcccg
gccaccgccctgtatccgtcgatgccgatcgcggccgcgcaggccggtgccgatctggtg
ctcgggatcggcgagatcgcccccgtgctggccgacctggtccacgggttgccgctgccg
cgacgatcgccgccggcagacgcgccggacgaggcccacctggatggcggcgtcgacccg
gacggcatcttcgcccggctggcggcccggttcggcgccaacaccccggcggcgcgcgcc
gaactcgcccggctgcgcgcggccgaactgcgccgccgccgccaggagctgtccgccggt
gtcggcgccacccgggagacggtggccacggcgcagcgccgggccgaggagtcgcgccgg
cgcgccctgctggcccaccgggccgccgacgaggcctgggcgcgctccgaacaggagcac
cgcgaccgggacggctaa

DBGET integrated database retrieval system