KEGG   Mycobacterium avium 104: MAV_4129Help
Entry
MAV_4129          CDS       T00433                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mav  Mycobacterium avium 104
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MAV_4129
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MAV_4129
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MAV_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4255922..4256410
Genome map
AA seq 162 aa AA seqDB search
MTVKNIPLTTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAEDYAARGLTVVG
VPCNQFMGQEPGTPEEIREFCSTNYGVTFPLLAKTDVNGDDRHPLYAELTKAADADGHAG
DIQWNFEKFLISPDGEVVRRFRPRTEPDAPEVISAIEAVLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgaaaaacatcccgctgaccacactcgacggccggcccaccacgctggccgaa
ttgtccgatggcgcaacgctggtcgtcaacgtcgcctccaaatgcgggctgactccgcaa
tacacggccctggagaaactggccgaggactacgccgcgcgcggcctgaccgtcgtgggg
gtgccgtgcaaccagttcatgggtcaggagcccggcacgcccgaggagatccgggagttc
tgctcgaccaactacggtgtgacgttcccgctgctggccaagaccgacgtcaacggcgac
gaccggcacccgctgtacgccgagctgaccaaggccgccgacgccgacggccacgccggg
gacatccagtggaacttcgagaagttcctcatctcccccgacggtgaggtggttcgccgc
ttccggccccgcaccgaacccgacgcgcccgaggtgatcagcgccatcgaggccgtgctg
ccccgctag

DBGET integrated database retrieval system