KEGG   Mycobacterium avium 104: MAV_4239Help
Entry
MAV_4239          CDS       T00433                                 

Gene name
pstS
Definition
phosphate ABC transporter phosphate-binding protein PstS
Orthology
K02040  
phosphate transport system substrate-binding protein
Organism
mav  Mycobacterium avium 104
Pathway
ABC transporters
Two-component system
Tuberculosis
Module
Phosphate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mav02010]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mav02020]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mav05152]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4369494..4370594)
Genome map
AA seq 366 aa AA seqDB search
MSFARSGAVLSLLAAAALTLTGCGGDSKSSSGSGAHVDCGGKKVLKDSGSTAQQNAIEQF
VYAYVRACPGYTLDYNANGSGAGVTQFLNNQTDLAGSDIPLDPTTGQTDRAAARCNSPAW
DLPTVFGPIAVTYHLTGVSGLKLDGPTVAKIFNGAITKWDDPALKAVNPGLNLPSTPIAV
IFRSDKSGTTANFQKYLDGASNGAWGKGTSEMFTGGVGQGASGNNGTSALLQNTEGSITY
NEWSFAVGKQLSMASIITSAGPDAVPITKESVEKTIAGATFQGQGNDLVLDTSSFYRPTQ
QGAYPIVLATYEIVCSKYPDAATGSAVKAFMQAAIGPGQDGLDQYGSIPLPGSFTAKLSS
AVNAIS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgctcgatctggcgccgtactgagcctgctggccgccgccgcgttgacgctg
acggggtgcggcggcgactccaagtcgtcgtcggggtcgggcgcgcacgtggactgcggc
ggcaagaaggtgctcaaggacagcgggtccaccgcccagcagaacgcgatcgagcaattc
gtctacgcctacgtccgggcctgcccgggctacacgctggactacaacgcgaacggctcc
ggcgccggtgtcacgcagttcctcaacaatcagaccgacctcgcgggttcggatatcccg
ctggaccccaccaccggccagaccgaccgggcggcggcgcggtgcaattcgcccgcctgg
gacctgccgaccgtgttcgggccgatcgcggtgacctaccacctcaccggggtgagcggg
ctcaaactggacgggccgaccgtcgcgaagatcttcaacggcgccatcaccaagtgggac
gacccggcgctcaaggcggtcaatccgggcctcaacctgccgtcgacgcccatcgcggtg
atcttccgcagcgacaagtccggcaccaccgccaactttcagaagtacctggacggggcg
tccaacggcgcctggggcaagggcaccagcgagatgttcaccggcggcgtcgggcagggg
gccagcggcaacaacggcacctcggcgctgctgcagaacaccgaggggtcgatcacctac
aacgagtggtcgttcgcggtcggcaagcagctgagcatggcgtcgatcatcacctcggcg
gggccggacgcggtgcccatcaccaaggagtccgtcgagaagaccatcgccggggccacc
tttcaggggcagggcaacgacctggtgctggacacctcgtcgttctaccggcccacccag
cagggcgcctacccgatcgtgctggcgacctacgaaatcgtctgctcgaaatatccggac
gcggcgacggggtccgcggtgaaggcgttcatgcaggccgcgatcggtcccggccaggac
ggtctggaccagtacggttccatcccgctgccgggttcgttcacggcaaagctgtcgagc
gcggtcaatgcgatttcctga

DBGET integrated database retrieval system