KEGG   Mycobacterium avium 104: MAV_4298Help
Entry
MAV_4298          CDS       T00433                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mav  Mycobacterium avium 104
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_4298
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAV_4298
   00650 Butanoate metabolism
    MAV_4298
  Energy metabolism
   00190 Oxidative phosphorylation
    MAV_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4428604..4429074
Genome map
AA seq 156 aa AA seqDB search
MSTPDLQLGPGQIAPVKQRFYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGVALFVL
AIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNISG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgacctgcagctcggcccgggccagatcgccccggtcaaacagcgcttc
tacgaccgcccggccagcctggacaatccccgctccccgcggcgccgcgccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctccggcgtcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacgacggcgtgtaccgcatcgacttc
aactacgtggcgcagcgctgggcgtcgccgttctggcagttctgggacctggcgctgctg
tggctggcccagctgcacggcggcaacgggctgcgcaccatcatcgacgactacagccgc
aaggacagcacccggttctggctgaacagcctgctgctgctgtcgatgggcttcaccctg
gtgctgggcacctacgtgctgctgaccttcgacccgaacatctcgggatag

DBGET integrated database retrieval system