KEGG   Mycobacterium avium 104: MAV_4354Help
Entry
MAV_4354          CDS       T00433                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mav  Mycobacterium avium 104
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MAV_4354
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MAV_4354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4492771..4494507)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWDLRKFLWAPKL
GCYGIQRIHPLKNVLILAGAGVGGGSLNYANTLYVPPEPFFKDQQWAHITDWRDELMPHY
DQAQRMLGVVTNPTFTDADRIVKEVADEMGCGDTFVPTPVGVFFGPDGTKAPGKTVPDPY
FGGAGPERTGCLECGCCMTGCRYGAKNTLLKNYLGLAESAGAQVLPMTTVKAFEQRPDGL
WQVRTVRTGSWVRRDRRTYTAKHLILAAGTWGTQHLLFKMRDEGRLPRLSNRLGVLTRTN
SESIVGAGKLEVDPNLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGAG
PQGTDVPRWKQLLDQAREDPRRLMRLLNVHQWSERTLIALVMQHLDNSITTFTKRGRLGI
RWYTSKQGHGEPNPTWIPVGNEVTRRIAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGQD
AEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSITAQAERAAALWPNNGENDQRPA
QGEPYRRMDPIAPKAPVVPAEAPGALRWTPTKPVSSAS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcctgatcatcggttcgggtttcgggggcagcgtcagcgcg
ttgcggctgaccgagaagggctaccgggtgggcgtgctggaggccggccgccggttcgcc
gacgaggatttcgccgagacatcctgggacctgcgcaagttcctgtgggcgccgaagctg
ggctgctacggcatccagcgcatccacccgctcaagaacgtgctgatcctggccggcgcg
ggggtgggcggcggctcgctgaactacgccaacaccctctacgtgccgccggagccgttc
ttcaaagaccagcagtgggcgcacatcaccgactggcgcgacgagctgatgccgcactac
gaccaggcccagcggatgctgggcgtggtgaccaacccgaccttcaccgacgccgaccgg
atcgtcaaagaggtcgccgacgagatgggctgcggcgacacgttcgtgcccaccccggtc
ggagtgttcttcggccccgacggcaccaaggcccccggcaagaccgtgccggacccgtac
ttcggcggcgccgggccggaacgcaccggctgcctggagtgcggctgctgcatgaccggc
tgccgctacggcgccaagaacaccctgctgaagaactacctgggtctcgcggaatcggct
ggggcgcaagtgcttccgatgacgacggtgaaggcgttcgagcaacgcccggacgggctg
tggcaggtccgcacggtgcgcaccggcagttgggtgcgccgcgacaggcgcacctacacc
gccaagcacctgatcctggccgccggcacctggggcacccagcatctgctgttcaagatg
cgcgacgagggccggctgccccggctgtccaaccggctgggcgtgctgacccgcaccaac
tccgagtccatcgtcggcgccggaaagctcgaggtcgaccccaacctggacctgacacac
ggggtggccatcacgtcgtcgatccatccgacgccggacacccacatcgagccggtccgc
tacggcaagggctccaacgcgatgggtctgctgcagacgctgatgaccgacggcgccggc
ccgcagggcaccgacgtgccgcgctggaagcagttgctggaccaggcccgcgaggatccg
cgccggttgatgcggttgctcaatgtccatcagtggagcgagcgcaccctgatcgcgctg
gtgatgcaacacctggacaactcgatcaccaccttcaccaagcgcggcaggctcggaatc
cgttggtacaccagcaaacagggccacggcgagccgaaccccacctggatcccggtcggc
aacgaggtcacgcggcgcatcgccgccaagatcgacggcgtggccggtggcacctggggg
gagctgttcaacatcccgctgaccgcgcacttcctgggtggcgcggtgatcggccaggac
gccgagcacggcgtcatcgacccctaccaccgggtctacggctatccgacgctgtatgtg
gtggacggcgccgccatctcggccaacctgggcgtcaacccctcgctgtccatcaccgcc
caagccgagcgggcggcggcgttgtggcccaacaacggcgagaacgaccagcgccccgcg
cagggcgagccgtatcggcggatggatccgatcgcgcccaaggcgccggtggtcccggcc
gaggcgccgggcgcgctgcgctggacaccgaccaagccggtcagctcggccagctag

DBGET integrated database retrieval system