KEGG   Mycobacterium avium 104: MAV_4439Help
Entry
MAV_4439          CDS       T00433                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mav  Mycobacterium avium 104
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mav00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4574369..4575022
Genome map
AA seq 217 aa AA seqDB search
MKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYRDMQLDDLVLI
DPAGSVLQAAQGRSPSTEMQLHLACFAAFDDIGCVIHSHPVWATMFAIAHQSIPACIDEF
AVYCGGDVRCAEYAASGSPDVGANAVKALQGRGAALIANHGLVAVGPRPDKVLHITALVE
RTAQIVWGARALGGPVPIPEDVNRNFAAVYGYLRANP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtcgacgacccggaacaggcggtgctggacgccgccaaggacatgctgcgc
cgcggcctggtggagggcaccgccggcaacatctcggcgcgccgctccgacggcaacatc
gtcatcacgccatcatcggtggactaccgcgacatgcagctcgacgacctggtgctgatc
gaccccgccggttcggtgctgcaggccgcgcagggccgctcgccgtccacggagatgcag
ctgcacctggcctgcttcgccgcgttcgacgacatcggctgcgtcatccacagccatccg
gtgtgggcgaccatgttcgccattgcgcaccaatcgattccggcgtgcatcgacgagttc
gcggtgtattgcggcggcgacgtgcgctgcgccgagtacgccgcctccggctcccccgac
gtcggcgccaacgcggtcaaggcgctgcagggccgcggcgccgccctgatcgccaaccac
ggcctggtggcggtgggcccgcggcccgacaaggtcctgcacatcaccgcgctggtggag
cggaccgcccaaatcgtctggggcgcaagggctctcggcggtccggtgccaattcccgag
gacgtcaaccgcaacttcgccgcggtgtacggctatctgcgcgccaacccctga

DBGET integrated database retrieval system