KEGG   Mycobacterium avium 104: MAV_4499Help
Entry
MAV_4499          CDS       T00433                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mav  Mycobacterium avium 104
Pathway
mav00071  Fatty acid degradation
mav00280  Valine, leucine and isoleucine degradation
mav00281  Geraniol degradation
mav00310  Lysine degradation
mav00360  Phenylalanine metabolism
mav00362  Benzoate degradation
mav00380  Tryptophan metabolism
mav00410  beta-Alanine metabolism
mav00627  Aminobenzoate degradation
mav00640  Propanoate metabolism
mav00650  Butanoate metabolism
mav00903  Limonene and pinene degradation
mav00930  Caprolactam degradation
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01212  Fatty acid metabolism
Module
mav_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAV_4499
   00650 Butanoate metabolism
    MAV_4499
  Lipid metabolism
   00071 Fatty acid degradation
    MAV_4499
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAV_4499
   00310 Lysine degradation
    MAV_4499
   00360 Phenylalanine metabolism
    MAV_4499
   00380 Tryptophan metabolism
    MAV_4499
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAV_4499
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAV_4499
   00281 Geraniol degradation
    MAV_4499
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAV_4499
   00627 Aminobenzoate degradation
    MAV_4499
   00930 Caprolactam degradation
    MAV_4499
Enzymes [BR:mav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAV_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756 DUF5320
Motif
Other DBs
NCBI-ProteinID: ABK64500
UniProt: A0A0H2ZQN1
Position
complement(4623696..4624634)
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALVERADLDPNVH
VILVSGRGAGFCAGFDLSAYADRTGSAGGTGAYAGTVLDGKTQAVNHLPDQPWDPMIDYQ
MMSRFVRGFSSLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPDPADLDERTERLVQRIAAVPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGVARHTPEGHAFVADAVKHGFREAVRHRDE
PFGDHGRQASQV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgcgatcaggccggtcgacttcgacaacctgaaaacgatgacctatgaggtc
accgaccgggttgcccggatcaccttcaaccgccctgagaagggcaacgcgatcgtcgcg
gacaccccgctggagctctccgcgctggtggagcgggccgacctggatcccaacgtgcac
gtcatcctggtctccggccgcggcgcgggcttctgcgcgggcttcgacctgagcgcctac
gccgatcgcaccggttcggccggcgggaccggtgcctacgcgggcaccgtgctggacgga
aaaacccaggcggtcaaccatttacccgatcagccgtgggacccgatgatcgactatcag
atgatgagccgtttcgtgcggggcttctcctccctgatgcacgccgacaaaccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacattgcgctgcacgccgaccag
gtgatcgccgccgccgacgccaagatcggctacccgccgacgcgggtgtggggcgtgccg
gccgccggcctgtgggcgcaccggctgggcgatcagcgcgccaagcggctgctgttcacc
ggcgattgcatcaccggcgcgcaagccgccgaatggggtctggccgtcgaggcgcccgat
ccggccgatctcgacgagcgcaccgagcggctggtgcagcggatcgcggcggtgccggtc
aaccagctgatcatggtcaagctcgcgctgaattccgctctgctgcaacagggggtggcc
accagccggatggtcagcacggtgttcgacggcgtcgcccggcacaccccggagggccac
gccttcgtcgccgacgccgtgaagcacggattccgtgaggcggtgcggcatcgcgacgaa
ccgttcggcgaccacggccggcaagcctcgcaggtgtag

DBGET integrated database retrieval system