KEGG   Mycobacterium avium 104: MAV_4510Help
Entry
MAV_4510          CDS       T00433                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mav  Mycobacterium avium 104
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_4510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_4510
   00052 Galactose metabolism
    MAV_4510
   00500 Starch and sucrose metabolism
    MAV_4510
   00520 Amino sugar and nucleotide sugar metabolism
    MAV_4510
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MAV_4510
   00524 Butirosin and neomycin biosynthesis
    MAV_4510
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MAV_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4640564..4641484)
Genome map
AA seq 306 aa AA seqDB search
MLTLGLDIGGTKIAAALVDSSGTLVHTAVRPTPNPAPADDVWDVVHALIAEVVRAADAPI
AAVGIASAGPVDLPSGSVSPINIAGWHRFPLRDKVAAAVPATPVVLGGDGLCMALGEQWL
GAGRGARFLLGMVVSTGVGGGLVLDGAPYPGRTGNAGHVGHVVVELDGRPCTCGGHGCVE
TVASGPSMVRWARENGWSAAPGAGARDLAAAAASDPLAQKAFHRSADALAAMIASVGAVC
DLDVVVIGGGVAQSGPLLFDPLRERLAHYAGLDFLSGLTVVPGELGGNAGLIGAARLATL
ARPAGS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctcggcctggacatcggcggcaccaaaatcgctgccgcacttgttgattcg
tccggcacgctggtccacaccgccgtccgccccacccccaacccggcccccgccgacgat
gtgtgggatgtggtgcacgccctgatcgccgaggtggtgcgggcggccgacgccccgatc
gcggccgtgggcatcgcgtcggccgggcccgtcgacctacccagcggatccgtcagcccg
atcaacatcgccggctggcaccgtttcccgttgcgcgacaaggtcgccgcggcggtgccg
gcgacaccggtggtgctgggcggcgacgggctctgcatggcgctgggggagcagtggctg
ggcgcgggacgcggcgcccgcttcctgctgggcatggtggtctccaccggggtgggtggc
ggcctggtgctcgacggcgccccctacccgggccgcaccggcaacgccggtcacgtcggg
cacgtggtggtcgaactggacggccggccctgcacctgcggcgggcacggctgcgtggag
acggtggcctccgggccgtcgatggtgcgctgggcgcgcgaaaacgggtggtcggcggcg
ccgggggccggcgcccgggacctggccgccgccgcggcctcagacccgttggcgcagaag
gcgtttcaccggtcggccgacgcgctggcggcgatgatcgcctcggtcggtgcggtgtgc
gatctggacgtggtggtgatcgggggaggcgtcgcccagtccgggccgctgctgttcgac
ccgctgcgcgaaaggctggcccactacgccgggctggacttcctgtccgggctgacggtg
gtgccgggggaactcggcggcaatgccggactgatcggcgcggcccggctggcgaccctg
gcgcgacccgccggctcctag

DBGET integrated database retrieval system