KEGG   Mycobacterium avium 104: MAV_4544Help
Entry
MAV_4544          CDS       T00433                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mav  Mycobacterium avium 104
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mav00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAV_4544 (recD)
Enzymes [BR:mav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MAV_4544 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4674395..4676107
Genome map
AA seq 570 aa AA seqDB search
MLPERVFDAGPLRPFADAGIFEAADIHVAQRLTALTGESDDRVALAVALLVRALRGGSVC
VDLRAVPAQVGAADLPWPAAGDWLAAVRASPLLGPPPVLRFFGDLLYFDRYWLEEEQVCT
DLLALSAPAGDVESSCYERLFPPGYEEQRAAARIAVSQALTVLTGGPGTGKTTTVARLLA
LLVEQAERAGEPRPRIALAAPTGKAAARLAEAVAAEIEHLDPADRARLAGLTGTTLHRLL
GPRPDTSVRFKHNRGNRLPHDIIVVDETSMVSLTMMARLAEAVRPDTRLILVGDPDQLAS
VEAGAVLADLVDGLAGRAGVRVAALATPHRFGSAIGALAAAIRAGDADRVVELLAAGGEH
IEWVDSERPADRLREVLVSHALRLRSAALLGAAQAALATLDEHRLLCAHRDGPHGAVRWN
TLVHNWIAEETGQPAWSQWYAGRPLLVTANDYGLRLYNGDTGVTVAGADGLRAVIAGAAG
PLDFATSRLGEVETMHAMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAKSRVR
VVGPEASVRAAIERRAIRATGLRQRLRVVG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgttgccggagcgggtgtttgacgccgggccgctgcgcccgttcgccgacgccggcatc
ttcgaagcagcggatatccatgtggcgcaacggcttaccgcgctcaccggcgagtccgac
gatcgggtggcgctggccgtcgccctgctggtgcgcgcgctgcggggcggttcggtgtgc
gtcgatctgcgggcggtgccggcacaggtcggcgcggcggacctgccctggcccgccgcc
ggcgactggctggccgcggtgcgggccagcccgctgctcgggccgccgccggtgctgcgg
ttcttcggcgatctgctctacttcgaccggtactggctggaggaagagcaggtgtgcacc
gatctgctggccctgtcggcgccggcgggcgatgtcgaatcctcttgctacgaaaggctt
ttcccgcccggctacgaagaacagcgggcggccgcccggatcgcggtgtcccaggcgctc
accgtgctgaccggcgggccgggcaccggcaagaccaccacggtcgcgcggctgctcgcc
ctgctggtcgagcaggccgagcgcgccggtgagccgcggccgaggatcgcgctggccgcc
ccgaccggcaaggcggccgcgcggctggccgaggcggtggccgccgagatcgagcacctc
gacccggccgaccgggcgcggctggccgggctgaccggcaccacgctgcaccggctgctg
gggccgcgccccgatacgtcggtgcggttcaagcacaatcgcggcaaccggctgccacac
gacatcatcgtggtcgacgagacgtcgatggtgtcgttgaccatgatggcccggctggcc
gaagccgtccggccggacacccggctgatcctggtcggcgatcccgaccagttggcctcg
gtggaggcgggcgccgtgctggccgatctggtcgacgggctggccggccgcgccggggtg
cgggtcgccgcgctggccaccccgcaccggttcggcagcgcgatcggcgcgctggccgcg
gcgatccgggccggcgacgccgaccgggtggtggagttgttggcggccggcggtgagcac
atcgagtgggtggattccgaacgcccggccgaccggctgcgcgaggtgctggtgtcgcac
gcgctgcggttgcgctcggcggcgctgctgggcgcggctcaggccgcgctggccacgctg
gacgagcaccggctgctgtgtgcgcaccgcgacgggccgcacggggcggtgcggtggaac
acgttggtgcacaactggattgccgaagaaaccggtcagccggcctggtcgcaatggtat
gccgggcgtccgctgctggtgacggcgaacgactacgggctgcgtctgtacaacggcgac
accggcgtgacggtggccggtgcggacgggctgcgggccgtcatcgccggtgcggccggc
ccgctggacttcgccaccagccggctgggcgaggtggagacgatgcacgccatgaccatc
cacaagagtcagggcagccaggccgacgaggtgacggtgctgataccgccggaggattcg
cggctgctgacccgggaactgttctacacggcggtgacccgggccaagagcagggtgcgg
gtggtggggcccgaggcgtcggtgcgggccgcgatcgagcgccgggcgatccgggccacc
ggactgcggcagcggctgcgggtggtcgggtga

DBGET integrated database retrieval system