KEGG   Mycobacterium avium 104: MAV_4682Help
Entry
MAV_4682          CDS       T00433                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mav  Mycobacterium avium 104
Pathway
mav00630  Glyoxylate and dicarboxylate metabolism
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01200  Carbon metabolism
Module
mav_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAV_4682 (aceA)
Enzymes [BR:mav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MAV_4682 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABK64444
UniProt: A0A0H2ZQI0
Position
complement(4810799..4812085)
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEEIQKDWDTNPRWKDVTRTYTAEDVVALQGTVVEENTLARRGAEVLWEQL
HDLEYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPTV
VRRINNALLRADQIAKVEGDTSVKNWLAPIVADGEAGFGGALNVFELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVCDVPTVVIARTDAEAATLITSD
VDERDQPFITGERTKEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFAEG
VKAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgttggcacccccaagagcgccgaggagatccagaaggactgggacaccaac
ccgcgctggaaggatgtcacccgcacctacaccgccgaggacgtcgtcgccctgcagggc
accgtcgtcgaggagaacaccctggcccgccggggcgcggaggtgctgtgggagcagctg
cacgacctggagtacatcaacgcgctgggcgccctgaccggcaacatggccgtgcagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggtgacgccaac
ctgtccggtcacacctaccccgaccagagcctgtaccccgccaactcggtgccgaccgtg
gtgcgccggatcaacaacgcgctgctgcgcgcggaccagatcgccaaggtcgagggcgac
acctcggtgaagaactggctggcgccgatcgtcgccgacggcgaggccggcttcggtggt
gcgctcaacgtcttcgagctgcagaaggcgatgatcgccgccggtgtggcgggctcgcac
tgggaggaccagctggcttcggagaagaagtgcggccacctgggtggcaaggtgctgatc
ccgacccagcagcacatccgcacgctgacctcggcccggctggccgccgacgtgtgcgac
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcaccaaggagggcttctaccgg
gtccgcaacggcctcgagccctgcatcgcccgggccaaggcctacgcgccgtactccgac
ctgatctggatggagaccggcacgcccgacctggagctggccgccaagttcgccgagggc
gtcaaggccgagttccccgaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcacctcgacgacgccaccatcgcgaagttccaaaaggagcttgccgcaatggga
ttcaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgaccgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggttacaccgccaccaagcaccagcgcgaggtgggcgccggt
tacttcgaccggatcgccaccacggtcgacccgacgtcgtcgaccaccgcgctgaccggc
tccaccgaagagggccagttccactga

DBGET integrated database retrieval system