KEGG   Mycobacterium avium 104: MAV_4900Help
Entry
MAV_4900          CDS       T00433                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mav  Mycobacterium avium 104
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mav00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5034348..5035511
Genome map
AA seq 387 aa AA seqDB search
MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVTSAAAINIIALPEDQELHRH
TEAVITQPPDILVAHTGIGFRGWVAAADGWGLAPQLLSALSQARIVARGPKATGALRAAG
LHEEWSPKSESSREVLRYLLDSGVAGKRIAVQLHGAADGWDPFPEFINGLRSAGAQVMPI
HVYRWKPTPAGGEFDQLVASVARRQFDAVTFTSAPAGAALLERSRELGIEDQLLQALRSD
VHAMCVGPVTAQPLIRAGVPTSSPERMRLGALARHIAQELPPLRSCTLRAAGHQIEIRGT
CVLVDGAVKSLSGSAMATLRALAARPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTAL
GDKNIIATVVKRGYRLAIDTPDGSAWH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcaactggccccgccggactccgcgccgctcaccggctaccggatcgccgtc
acctcggcgaaccgggccgaggagctgtgcgcgttgctgcgccgcaacggcgcggaagtc
accagcgccgccgccatcaacatcatcgcgctgccggaggaccaggagctgcaccgccac
accgaggcggtgatcacccaaccgcccgatatcttggtggcgcacaccgggatcggcttc
cgcggctgggtcgccgcggccgacggctgggggctggccccccaactgctgtcggcgctg
tcgcaggcccggatcgtggcccgcgggcccaaggcgacgggcgcgttgcgcgccgccggg
ctgcacgaggagtggtcgccgaaatccgaatcgtcgcgcgaggtgttgcgctacctgctc
gactccggtgtggccggcaagcggatcgcggtgcagctgcacggcgcggccgacggctgg
gatcccttcccggagttcatcaatgggcttcgctcggccggcgcgcaggtgatgcccatc
cacgtctaccgctggaagccgacaccggccggcggagaattcgaccaactcgtcgcctct
gtggcgcggcggcagttcgacgcggtcaccttcacctcggcgcccgccggcgcggcgctg
ctggagcgcagccgcgagctgggcatcgaagaccaactgctgcaagcacttcgcagcgac
gtgcacgccatgtgcgtggggccggtgaccgcgcagccgttgatccgcgcgggtgtgccg
acgtcgtcgccggagcggatgcggttgggggcgttggcccgtcacatcgcccaggagttg
ccgccgctgcgctcgtgcacgttgcgggcggccgggcaccagatcgagatccgcggcacc
tgtgtgctggtcgacggcgcggtcaagtcgctgtccgggtcggccatggcgacgctgcgc
gcgctggcggcgcgccccggtgacgtggtcgcgcgcaacgacttgctgcgggtgcttccc
ggcaacagcaacgacccgcacgccgtcgacacggccgtgctgcggctgcgaacggcgctg
ggcgacaagaacatcatcgcgacggtggtcaagcgcggctaccggctggcgatcgacacc
ccggacggatcggcatggcactaa

DBGET integrated database retrieval system