KEGG   Mycobacterium avium 104: MAV_4920Help
Entry
MAV_4920          CDS       T00433                                 

Definition
glycosyl hydrolase 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mav  Mycobacterium avium 104
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAV_4920
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MAV_4920
Enzymes [BR:mav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MAV_4920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5054575..5055741)
Genome map
AA seq 388 aa AA seqDB search
MALSRPLAAHAAVLAAVSALMIGCAHRAAPPPAHSSTSNTPAAAPAPRVCVDPPAAPATL
NLRDKLAQLLMVGVKNADDARNVVNGYHVGGIFIGSWTDLTIFQGPLADIAAKAGPLPLA
VSVDEEGGRVSRLKSLIGTSPSPRELAQTQTVQQVHDLAADRGKKMRDLGITIDFAPVVD
VSDEPDDAVIGNRSFGADPAKVTEYAGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGV
VTPPLDDLQNNDLVPYRTLVTTPPVGVMVGHLQVPGLTDDVPASLSPEAVQLLRNGVGYK
GPPFTGPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRLQKAVA
SGELPAQRVDESLVRVATMKGRGPACGH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcgcgccccctcgccgcgcacgcggccgtgctggccgccgtgtcggcgctg
atgatcggctgcgcccaccgcgccgcacccccgcccgcgcactcgtcgacgtcgaacacg
ccggccgctgccccggcgccgcgggtgtgcgtcgacccgccggcagcgccggccaccctg
aaccttcgcgacaagctggcccaactgctgatggtgggtgtcaagaacgccgacgacgcg
cgcaacgtcgtcaacggctatcacgtcggcggcatcttcatcggcagctggacggacctg
acgatcttccagggcccgctggccgacatcgcggccaaggcggggccgttgccgctggcg
gtcagcgtcgacgaggagggcggccgggtctcgcggctgaaatccctgatcgggacgtcg
ccgtcgccgcgtgagctggcgcagacgcagaccgtgcagcaggtgcacgacctggccgcc
gaccgcggcaagaagatgcgcgacctaggcatcaccatcgatttcgcgcccgtcgtcgac
gtcagcgacgagcccgacgacgccgtgatcggcaaccgttcgttcggcgcggacccggcc
aaggtcaccgagtacgccggtgcgtatgcgcaggggctgcgggacgccggcctgttgccc
gtgctcaagcacttccccggccacgggcacggctcgggtgactcccacaccggtggcgtg
gtcacgccgccgctggacgacctgcagaacaacgacctggtgccctaccggaccctggtg
accacgccgccggtcggggtgatggtaggccacctgcaggttcccgggctcaccgacgac
gtgccggccagcctgagccccgaggcggtgcagttgctgcgcaacggcgtcggctacaag
gggccgccgttcaccggcccggtcttcagcgacgatctgtccagcatggcggccatctcc
gaccgatacggggtctccgaggcggtgctgcgcagcctgctggccggcgtcgacgtcgcc
ttgtgggtcaccaccgacgaggtgccggcggtgctggaccggctgcagaaggcggtcgcc
tcgggcgaattgccggcacagcgggtggacgagtcgctggtgcgggtggcgaccatgaag
ggccgcggcccggcctgcgggcactag

DBGET integrated database retrieval system