KEGG   Mycobacterium avium 104: MAV_5155Help
Entry
MAV_5155          CDS       T00433                                 

Definition
hypothetical protein
Orthology
K06893  
 
Organism
mav  Mycobacterium avium 104
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5305597..5305998
Genome map
AA seq 133 aa AA seqDB search
MMTPFDDPQGELAWMFLQSTTEGGDLDEGFALLSDDFSYWTLYTRAACDKDTLRRAIERR
KQDLELTIDLVRCVNEGETVVVEAQAAGTTSAGVEYDSPFVCIFDTRDGLIVSMRVYSDT
RAVDNAMPGWIGY
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacgccgttcgatgatcctcagggcgaactggcctggatgttcttacagagcacc
accgagggcggcgatctggacgagggcttcgcgctgctcagcgacgacttcagctactgg
acgctctacacccgcgcggcttgcgacaaggacaccttgcggcgggcgatcgagcggcgc
aaacaagacctggagctgaccatcgacctggtgcgctgtgtcaacgagggcgagacggtc
gtggtggaggcgcaggccgccggaaccacctccgcgggcgtcgagtacgacagcccgttc
gtgtgcattttcgacacccgcgacgggctgatcgtgtcgatgcgcgtgtacagcgacacc
cgggcggtggataacgcgatgcccggatggatcggctactga

DBGET integrated database retrieval system