KEGG   Mycobacterium avium 104: MAV_5157Help
Entry
MAV_5157          CDS       T00433                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mav  Mycobacterium avium 104
Brite
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MAV_5157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5306604..5307623)
Genome map
AA seq 339 aa AA seqDB search
MSGKPKLVIGANGFLGSHVTRQLVADGAQVRAMVRAGANTRGIDDLSLTRFHGDVFDTAV
LSEAMDGVDDVYYCVVDTRAWVRDTSPLFRTNVEGLRNVLDVAVTQPELRKFIFTSTYAT
VGRRRGHVATEDDVIGTRGLSDYVKSRVQAENLVMRYVAEAGLPAVAMCVSTTYGSGDWG
RTPHGAFIAGAVFGKLPFTMEGIQLEVVGVTDAAKAMVLAADRGRVGERYLISERMIALK
EVVRIAADEAGVPPPRRSISVPTLYALGALGDLRARLTGKDAELSLASVRMMRAEAPVDH
SKAVRELGWQPRPVEESIREAARFWAAMRNAKGKSATPR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaaacccaaactggtcatcggcgccaacggttttctgggttcgcacgtgacc
cgccagctcgtcgccgacggggcgcaggtgcgcgcgatggtgcgcgccggcgccaacacc
cgtggtatcgacgacctttcgctaacccgcttccacggcgacgtgttcgacaccgcggtg
ctgtccgaggcgatggacggcgtcgacgacgtctactactgcgtggtcgacacccgcgcc
tgggtgcgcgacacctcgccgctgtttcgcaccaatgtcgaagggctgcgcaacgttctg
gatgtggccgtcacgcaacctgagctgcgcaagttcatcttcaccagcacctacgcgacg
gtcgggcgacggcgcgggcacgtggcgaccgaggacgacgtcatcggcacccgcgggctg
tccgactacgtcaaatcccgcgtgcaggccgaaaacctggtgatgcgctatgtggccgag
gccgggctgcccgcggtcgcgatgtgcgtgtcgaccacctacggcagcggcgactggggc
cgcaccccgcacggcgccttcatcgccggggccgtgttcggcaagttgccgttcaccatg
gagggcatccagctggaagtcgtcggcgtcaccgacgccgcgaaggccatggtcctggcc
gccgaccgcggccgtgtcggcgagcggtacctgatctccgagcggatgatcgcgctcaaa
gaggtggtgcggatcgccgccgacgaagccggggtgccgccaccgcggcgctcgatctcc
gtcccgacgctgtatgcccttggcgcactgggcgatctgcgcgcccggctcaccggcaag
gatgccgaactcagcctcgcctcggtgcgaatgatgcgcgccgaggcgcccgtcgaccac
agcaaggccgtccgcgaactcggttggcagccacgcccggtcgaggagtccattcgcgag
gcggcgcggttctgggcggcgatgcgaaatgccaagggcaagagcgcgactccccgctga

DBGET integrated database retrieval system