KEGG   Metarhizium acridum: MAC_01671Help
Entry
MAC_01671         CDS       T03104                                 

Definition
repressible alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
maw  Metarhizium acridum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAC_01671
Enzymes [BR:maw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MAC_01671
Exosome [BR:maw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAC_01671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 561 aa AA seqDB search
MESEQRPLLGNENQSHEIGRRHDSRRDSRWSRIREIGIFVWALIATAAVIIIAIATQHDQ
QTSRPDPRQAKRNLVFMVSDGMGPASLSLTRSYRQHVEGLPEQDTLVLDKHFWGSSRTRS
SSSLVTDSAAGATAFSCGKKSYNGAISVLPDFQPCGSVLEAAKRAGYATGLVVTTDITDA
TPACFASHVLIRQMQDSIALQEVGHGPLGRSVDLMLGGGRCHFMPNSTASSCRLDDVDVV
ALAQEKYGWSYADSRQAFDALHAGQNVTLPLLGLFASSDIPFELDRRNMNDVYPSLSEMA
QTALRTLEKATAKSDKGFFLMIEGSRIDHAGHINDPAAQVREVLEYDDTFKAVLDFIDDT
TTETILVATSDHETGGLATALQEPGHLPVYNWYPHVLANVSASCESLAQSLQSHVSNMSA
SISKQQLKSWINDKLVIPGLGVTDATDDELSLLADDPETSVNTFAAIISLRAHIGWSTHG
HTAVDVNVYSSGGPETERIRGNVENTEIGNFLSHYLDVDVDEVTQELREKTHISDDNSFH
ATQDQKGTGDWASDKYHTFED
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgagcaaagaccactcctcggcaacgagaaccaatcccatgaaattggcaga
cgtcatgatagccgaagggattcaaggtggtcacgaatccgcgaaatcggaattttcgtt
tgggccttgatcgctactgctgccgtcattatcatagccattgccacccagcatgatcaa
cagacgtccaggcccgacccgcgacaagccaaacgcaaccttgtctttatggtctcagat
ggaatgggccctgcctcactatcactgacccgcagctatcgtcagcacgtcgagggtctc
cctgagcaagacactctcgtcttggacaagcacttctggggctctagtcggacacgatct
agcagctccctggtcaccgacagtgccgctggtgctactgctttctcctgcggtaaaaag
agctacaatggtgccatttctgtgcttcccgactttcagccttgtggttctgttctcgaa
gctgcaaagagggccggatacgccactggtctggtcgtcacgaccgacatcaccgacgca
actccggcttgctttgcaagtcatgtcctgattaggcagatgcaggactccattgccttg
caagaagtcggtcatggacctcttggccgttcagttgatctcatgctgggtggtggacgg
tgccatttcatgcccaactctactgccagtagctgtcgtttggatgacgttgatgtcgtt
gccttggcgcaggaaaagtatgggtggtcgtatgcggacagccgccaggctttcgatgct
ctgcatgcaggtcaaaatgtcaccttgccgttattaggattgttcgcctcatcagacatc
cctttcgaactggacagaaggaacatgaatgacgtttatccaagcctcagcgagatggca
cagactgcactacgtactctggaaaaagctactgccaaaagcgataaaggctttttcctc
atgatcgagggtagccgtattgatcatgctggccacatcaatgatcccgccgctcaggta
cgagaggtcctggaatacgatgacacatttaaggccgtgttggatttcatcgatgacact
acgactgaaactatcctcgttgcaaccagtgaccatgagaccggtgggcttgctaccgct
ctccaggagcctggccaccttccagtttataactggtatccgcatgtactcgccaacgtc
tctgcctcgtgcgaaagcctggctcaatcgttacagagtcatgtgtccaacatgtctgct
tctatttccaagcaacagctcaaatcatggataaacgataagcttgttattcccggcctg
ggtgtcactgatgccacagatgatgagctttcgcttcttgctgatgaccctgagacttct
gtcaataccttcgctgctattatctctcttcgtgcacacattggctggagcacgcatggc
cacacagccgtcgacgtcaatgtctacagctctggcggcccagagactgaacgaatccga
ggcaacgttgagaataccgaaataggaaactttctcagccactatctagacgtagatgtt
gatgaggtcacacaggaactcagagagaagacccatatcagcgacgataacagttttcat
gcaactcaggatcaaaaagggactggagattgggcgtccgacaagtatcatacctttgaa
gactga

DBGET integrated database retrieval system