KEGG   Metarhizium acridum: MAC_03144Help
Entry
MAC_03144         CDS       T03104                                 

Definition
nitrate reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
maw  Metarhizium acridum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAC_03144
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MAC_03144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 313 aa AA seqDB search
MASNTKDSLLSRHYIDYVYVPAVLLVAGTLIVKKEWVPYSAALALVLGAYNFWNFQIKKV
LKPDVFQEFELQEKTVISHNVAIYRFKLPSSKSVLGLPIGQHISIGAPLKQQDGTTKEIV
RSYTPISGDHQPGYFDLLIKSYPQGNISKHMASLVVGQAIRVRGPKGAFVYTPNMVRHFG
MIAGGTGITPMLQIIRAIVRGRAEGDKTQVDLIFANVTPQDILLREDLDALAKEDSSIRI
HYVLDNPPEGWTGGVGYVTGDMITKWLPKPADDVKILLCGPPPMVSGLKKTTESLGYKKA
RPVSKLEDQVFAF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacaccaaggactcgttgctgtcgcgccactacatcgactatgtctatgtt
ccggccgtccttctcgtcgcggggaccctgattgtcaagaaggaatgggttccgtactcg
gctgctctggcgctggtgctgggcgcctacaacttctggaacttccagattaagaaggtt
ctcaagccagatgttttccaggagtttgagcttcaggagaagaccgtcatctctcacaat
gtcgccatataccgcttcaagctcccttcgtccaagtctgtcctcggcctccccatcggt
cagcacatctcgatcggcgcccctctcaagcagcaagatggcacaaccaaggagattgtg
cgctcatacaccccaatctccggcgaccaccagcccggatactttgatctcttgatcaag
tcttatccccagggcaacatctccaagcatatggcttccctggtggttggccaggccatt
cgcgtccgcgggcccaagggtgccttcgtctacacccccaacatggtccgccacttcggc
atgattgctggcggcaccggaatcacccccatgctccagatcatccgtgccatcgttcgt
ggccgcgccgaaggcgacaagactcaggtcgacctgatctttgccaacgtcacgccccag
gacattctcctgagagaggaccttgacgccctggcaaaggaggacagcagcattcgcatc
cactacgtcctggacaaccctcctgagggctggaccggtggtgtcggctacgtcaccggt
gacatgattaccaaatggctccccaagcccgccgacgacgtcaagattctcctctgcggt
cctccccccatggttagcggcctgaagaagaccaccgagagcctgggatacaagaaggcc
cgtcccgtcagcaagctcgaggaccaggtctttgctttttaa

DBGET integrated database retrieval system