KEGG   Metarhizium acridum: MAC_05850Help
Entry
MAC_05850         CDS       T03104                                 

Definition
alpha-amylase 1
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
maw  Metarhizium acridum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAC_05850
Enzymes [BR:maw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MAC_05850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 173 aa AA seqDB search
MGDYCGGTFQGLQAKLDYIRGMGFDAIWNHLDHPSGGQYAEPTLKRGEKKTTDISTDTAG
GYHGHWAQDLYSINAKYGSADDLKNLVNTAHERQMYVMVDVVANHMGPSALPSSTKARHI
TPPAKSTTRTRRPSRTAKYMYGFIAKVLDVKKSAGGLAGDDHAHLFVDSTAYA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattactgcggtggcacattccagggactgcaggcgaagctggactacatccgg
ggcatgggatttgatgccatctggaaccatctggatcaccccagtggtggccagtacgca
gagccaacgctcaagaggggggaaaaaaaaaccactgacatttcaacagataccgccggc
ggctatcacggacactgggctcaggacctctactccatcaacgccaagtacggcagcgca
gacgacttgaagaacctcgtcaataccgcccacgaaaggcaaatgtacgtcatggtggac
gtagtcgcaaaccacatgggcccgtctgccctcccctcctcaaccaaggctcgtcatatc
acgccccctgccaaatcgactactcgaaccagacgtccgtcgagaactgccaaatatatg
tacggattcatcgccaaggtgctggatgtcaagaagtcggcaggcggcctggcaggcgat
gaccacgcccatctgtttgtggactcgacggcgtacgcgtga

DBGET integrated database retrieval system