KEGG   Metarhizium acridum: MAC_08507Help
Entry
MAC_08507         CDS       T03104                                 

Definition
steroid 5 alpha-reductase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
maw  Metarhizium acridum
Brite
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MAC_08507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 362 aa AA seqDB search
MCKRFVKNHREHDRDLHLRLDHPPHAQDASPFSQLLVNGLAASRLLYLVKSRATRHRILV
RRTNHQESRAAMAIVEGWYPPTRENWETMVLTFQILYPALSLMQLFISWYGMGKTSVHSA
FNLPGRVAWMLMEMPGFTTVLYLMNTLPRMHGIDDLPWQNRVLAGLFVIHYVYRAVVFPF
IQPSMSPIHVLVALMAAGFQVLNGVSIGAWLAAYGPVTAEAWAARSSVAQFCVGIGIFYV
GLAANFFHDEELREIRRAERRRRQRVLDQQGGGGGAASVEKHYQIPQAGLFKHVLYAHYL
CEWVEWFGFLVAAGWGCVPAWTFLVNEVFAMLPRAVKGKKWYVEKFGEDKIRKRWAVLPG
VV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaagcgcttcgtcaaaaaccaccgcgagcatgatcgcgaccttcatttacggctg
gaccacccacctcatgcccaggacgcttctcccttttctcaactgctagtaaatgggctc
gcggcaagccgtcttttgtacttggtaaagtcgcgcgccacacgccatcgcatcttggtt
cgacgcaccaaccatcaggagtcgagagccgccatggccattgtagagggctggtaccct
cccacgagggagaactgggagacgatggtgctcaccttccagatactctaccccgctctc
tcgctcatgcagctcttcatctcgtggtacggcatgggcaagacgtcggtgcacagcgcg
ttcaacctgcccggccgcgtggcctggatgctcatggagatgcccgggttcacgacggtg
ctgtacctgatgaacacgctgccgcggatgcacggcatcgacgacctgccgtggcagaac
cgcgtgctggccggcctattcgtcatccactacgtctacagggccgtcgtgttccccttc
atccagccgtccatgtcgccgatccacgtgctcgtcgccctcatggcggcgggcttccag
gtcctcaacggcgtcagcatcggcgcctggctcgccgcctacgggcccgtcaccgccgag
gcctgggccgcgcgctcctccgtcgcccagttctgcgtcggcatcggcatcttctacgtc
ggcctggcggcaaacttcttccacgacgaggagctgcgggagattcggcgcgccgagagg
cgccgccggcagcgggtgctggaccagcagggcggcggcgggggcgccgccagcgtcgag
aagcactaccagatcccgcaggctgggctgttcaagcacgtcctttatgcgcactacttg
tgcgagtgggtggagtggtttgggttcctggtggctgctggctgggggtgcgtgcccgcg
tggacgtttttggtgaatgaggtctttgccatgctgccgcgggccgtcaaggggaagaag
tggtatgttgagaaatttggagaggacaagattcgcaagaggtgggcggttttgccgggt
gttgtttag

DBGET integrated database retrieval system