KEGG   Candidatus Methanomethylophilus alvus: MMALV_01880Help
Entry
MMALV_01880       CDS       T02624                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:max00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MMALV_01880
Enzymes [BR:max01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MMALV_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166949..168463
Genome map
AA seq 504 aa AA seqDB search
MKLKVKNVDVMASSPAVGMDPADCAEIGVKENDRVRVSNGKAEMSVLLLTSDAFVNVGEV
LVPNSVAKRLKVKDGDEVDVVFSPSPESVRSIRKKMDGEVLTDKEIQGVVNDIYLGSLSN
IEVSSWLTALYINGMNIDEIAAFARAMVDTGDVIPFDRSPVFDFHSMGGVPGNKITPIVV
SIVAAAGLMLPKTSSRAISSACGTSDFVETFCGIEVTAEKLKEIGETVGGAFVWGGSMNI
APVDDIVIKIEHPLGINPRAQMLASILSKKLAIGANYLLVDIPTGSGTKVPTIEVARAYA
RDFMDLGEKLGIHIECAITYADQPVGSAIGPNLEARECIRILEGNEHPASVIEKACECAG
IILEMGGFQNGTEKARELLRSGAAHRKFMEIVVAQGGSPDLKADDLKPGKFTADVVSSKS
GYVHSINNKDIVSIAKALGAPNDKGAGMLLLKKKGQRVEAGDVLFQLFADNEAKLARAKE
LADRYQPVAIEGMLIKRVTAPQPR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaggtgaagaacgtcgatgtgatggcatcctcccccgccgtggggatggat
cctgcggattgtgccgagataggtgtcaaggagaacgaccgcgtccgtgtatccaacggg
aaggcggagatgtcggtcctcctcctcacatccgatgcgttcgtcaacgtgggggaggtc
ctggtccccaactcggtggccaaaaggctcaaggtgaaggacggggacgaggtcgacgtg
gtattctcacccagtcccgagagcgtccgctccatcagaaagaagatggatggcgaggtc
cttaccgacaaggagatccagggagttgtcaacgacatctatctcggcagcctgtccaac
atagaggtgtcgtcctggctcacggccctttacataaacgggatgaacatcgacgagatc
gccgccttcgcaagggcgatggtcgacaccggcgatgtgatccccttcgacaggtcccct
gtattcgacttccacagcatggggggtgtgcccggcaacaagatcacccccatagtggta
tccatcgtcgccgcggcgggactgatgcttcccaagacgtcatcccgcgccatcagcagt
gcatgtggcacatccgatttcgtggagacgttctgcggtatcgaagtgacggccgagaag
ctcaaggagataggggagacggtcggcggcgccttcgtctggggcggatcgatgaacatt
gcccctgtggacgatatcgtgatcaagatcgaacatcctctcggaataaatccgagggcg
cagatgctggcgtccatactcagcaagaaactcgccataggcgccaactatctgttggtg
gacatccctacgggatccgggacgaaggtcccgacgatagaggtcgcccgggcatatgcc
agagatttcatggacctcggagagaagctgggtatccacatagagtgtgccataacctat
gccgatcagccggtggggagcgccatagggcccaatctggaggcgagggaatgcatccgc
atattggaagggaacgaacaccctgcgagcgtcatagagaaggcctgcgagtgtgccggc
ataatcctggagatgggcggattccagaacgggacggagaaggcacgcgaactcctgagg
tccggtgcggcacacaggaaattcatggagatagtggtcgcccagggcggaagtcccgac
ctgaaggccgacgacctcaaacccgggaagttcacggcggacgtcgtctcctcgaagtct
gggtatgtgcattccatcaacaacaaggatatcgtttcgatagcgaaggccctcggagca
cccaacgacaaaggtgccggaatgctccttcttaagaagaaaggacagagggtggaggct
ggggacgtattgttccagctcttcgccgacaacgaggccaagctggcccgcgcaaaggaa
ttggccgaccgttatcagccggtggccatagagggtatgctcataaagagggtcacggcg
ccccagcccaggtga

DBGET integrated database retrieval system