KEGG   Candidatus Methanomethylophilus alvus: MMALV_03760Help
Entry
MMALV_03760       CDS       T02624                                 

Definition
(GenBank) Catalase (EC:1.11.1.6)
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:max00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMALV_03760
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMALV_03760
  Amino acid metabolism
   00380 Tryptophan metabolism
    MMALV_03760
Enzymes [BR:max01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MMALV_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
341357..342865
Genome map
AA seq 502 aa AA seqDB search
MSPDKNLTSKNGAPVPDTEHSLTAGPRGPMMLQDVWFLEKLGHFDREVIPERRMHAKGSG
AFGKFTVTHDITRYTKAKLFSEVGKETEVFVRFSTVAGERGAADAERDIRGFAIKFYTED
GNWDLVGNNTPVFFIRDPLLFPDLNHAVKRDPKTNMRSAQNNWDFWTMIPEALHQVTIVM
SDRGIPYSYRHMHGFGSHTYSMINADGERTWVKYHLKTQQGIKNLTDAEAEEVIGKDRES
NQHDLFDAIERGEYPKWTMYIQVMTEEQARNYRENPFDITKVWPHGEFPLIEVGELELNR
NPENYFVDVEQSAFTPVNLVPGLGLSPDKLLQGRIFAYGDAQRYRLGVNHNLIPVNAPKC
PVNSYHRDGMMRTDDNFGSRKSYVPNSYGEWKENGVSEPALAIEGDIDRYDPSLDREDDV
YRQPGDLYRLMKPAEKDALIDNTARNMAAVTENIKYRHAAHCYRADPDYGYRLADAMGLK
RDTVQELAGLTEDELRKRTWSV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctgacaaaaatctcaccagcaagaatggtgcgcccgttcctgatacagagcac
tccttgactgcgggcccccgcggaccgatgatgttacaggacgtatggttcttggaaaaa
ctgggtcatttcgatcgcgaagtgatccccgagagacgtatgcatgccaagggttccggt
gcattcggaaagttcaccgtcacccacgacataacccgctacaccaaggcgaaactgttc
tcggaggtcgggaaggagactgaggtattcgtcagattctccaccgtggccggggagaga
ggggccgccgatgccgagcgcgacatcaggggtttcgccatcaaattctacaccgaggac
gggaactgggacctcgtcgggaacaacactcctgtgttctttataagggaccctcttttg
ttccccgacctcaaccacgccgtcaaaagggaccctaagaccaacatgaggtccgctcag
aacaactgggacttttggaccatgatcccggaagccctgcatcaggtaaccatcgtgatg
tcggaccgcggcatcccatactcatacagacatatgcatggattcgggagccacacatac
agcatgatcaacgctgacggcgagcgcacatgggtcaagtaccatctgaagacccagcag
ggaataaagaatctgaccgatgcggaggcggaggaggtcatcggaaaggacagggagagc
aaccagcacgaccttttcgacgccatcgaaagaggggagtatccgaaatggaccatgtat
atccaggtgatgaccgaagagcaggcccgcaactatagggagaatcccttcgacataacc
aaagtatggccccacggcgagttccctctgatcgaggtcggagagctggaactcaaccgc
aatccggagaattatttcgtcgacgtcgaacagtctgcattcacccctgtcaatctggtg
cctggtctggggctgtccccggacaagcttctgcagggaaggatattcgcatacggggat
gcacagaggtacaggctcggtgtgaatcataacctcattccggtcaatgcacccaagtgt
cctgtcaactcctatcatcgcgacggtatgatgaggacggatgacaatttcggttccagg
aagtcttatgtccccaacagttacggggagtggaaggagaacggggtcagcgaacctgcc
cttgccatagagggggacatagaccgctacgatccgtcgttggacagggaggatgacgtc
tatcgccagcccggtgatctgtacaggctcatgaagccggcggagaaagatgcactcata
gacaataccgcaagaaatatggccgcagtcaccgagaacatcaaataccgccatgctgcg
cattgctacagggcggatccggactacggatacaggcttgccgatgcaatgggtctgaag
agggatacggtccaggaattggccggtcttaccgaggacgaactcaggaagaggacctgg
tcggtctga

DBGET integrated database retrieval system