KEGG   Candidatus Methanomethylophilus alvus: MMALV_03760Help
Entry
MMALV_03760       CDS       T02624                                 

Definition
Catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:max00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMALV_03760
  Amino acid metabolism
   00380 Tryptophan metabolism
    MMALV_03760
Enzymes [BR:max01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MMALV_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
341447..342865
Genome map
AA seq 472 aa AA seqDB search
MLQDVWFLEKLGHFDREVIPERRMHAKGSGAFGKFTVTHDITRYTKAKLFSEVGKETEVF
VRFSTVAGERGAADAERDIRGFAIKFYTEDGNWDLVGNNTPVFFIRDPLLFPDLNHAVKR
DPKTNMRSAQNNWDFWTMIPEALHQVTIVMSDRGIPYSYRHMHGFGSHTYSMINADGERT
WVKYHLKTQQGIKNLTDAEAEEVIGKDRESNQHDLFDAIERGEYPKWTMYIQVMTEEQAR
NYRENPFDITKVWPHGEFPLIEVGELELNRNPENYFVDVEQSAFTPVNLVPGLGLSPDKL
LQGRIFAYGDAQRYRLGVNHNLIPVNAPKCPVNSYHRDGMMRTDDNFGSRKSYVPNSYGE
WKENGVSEPALAIEGDIDRYDPSLDREDDVYRQPGDLYRLMKPAEKDALIDNTARNMAAV
TENIKYRHAAHCYRADPDYGYRLADAMGLKRDTVQELAGLTEDELRKRTWSV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggacgtatggttcttggaaaaactgggtcatttcgatcgcgaagtgatcccc
gagagacgtatgcatgccaagggttccggtgcattcggaaagttcaccgtcacccacgac
ataacccgctacaccaaggcgaaactgttctcggaggtcgggaaggagactgaggtattc
gtcagattctccaccgtggccggggagagaggggccgccgatgccgagcgcgacatcagg
ggtttcgccatcaaattctacaccgaggacgggaactgggacctcgtcgggaacaacact
cctgtgttctttataagggaccctcttttgttccccgacctcaaccacgccgtcaaaagg
gaccctaagaccaacatgaggtccgctcagaacaactgggacttttggaccatgatcccg
gaagccctgcatcaggtaaccatcgtgatgtcggaccgcggcatcccatactcatacaga
catatgcatggattcgggagccacacatacagcatgatcaacgctgacggcgagcgcaca
tgggtcaagtaccatctgaagacccagcagggaataaagaatctgaccgatgcggaggcg
gaggaggtcatcggaaaggacagggagagcaaccagcacgaccttttcgacgccatcgaa
agaggggagtatccgaaatggaccatgtatatccaggtgatgaccgaagagcaggcccgc
aactatagggagaatcccttcgacataaccaaagtatggccccacggcgagttccctctg
atcgaggtcggagagctggaactcaaccgcaatccggagaattatttcgtcgacgtcgaa
cagtctgcattcacccctgtcaatctggtgcctggtctggggctgtccccggacaagctt
ctgcagggaaggatattcgcatacggggatgcacagaggtacaggctcggtgtgaatcat
aacctcattccggtcaatgcacccaagtgtcctgtcaactcctatcatcgcgacggtatg
atgaggacggatgacaatttcggttccaggaagtcttatgtccccaacagttacggggag
tggaaggagaacggggtcagcgaacctgcccttgccatagagggggacatagaccgctac
gatccgtcgttggacagggaggatgacgtctatcgccagcccggtgatctgtacaggctc
atgaagccggcggagaaagatgcactcatagacaataccgcaagaaatatggccgcagtc
accgagaacatcaaataccgccatgctgcgcattgctacagggcggatccggactacgga
tacaggcttgccgatgcaatgggtctgaagagggatacggtccaggaattggccggtctt
accgaggacgaactcaggaagaggacctggtcggtctga

DBGET integrated database retrieval system