KEGG   Candidatus Methanomethylophilus alvus: MMALV_12590Help
Entry
MMALV_12590       CDS       T02624                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:max00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MMALV_12590
Enzymes [BR:max01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MMALV_12590
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MMALV_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262329..1263174
Genome map
AA seq 281 aa AA seqDB search
MTGFRIIMPELPEIETVRRVVGPQVEGRTFVSVRAADNRILANTDPPGLSERLTGRTVVS
VGRRGKALLLYDDLRGHTVIRFGMTGQLYVCPPDTAEERHTHEVFLLDDGMELRYVDPRR
FGHIWHFRRDEEDTSGIRGLGLEPDDPGLDAGYLKDRLGSRGITVKEGLLDQTVVAGIGN
IWSDEMLFKAGICPLTPCRDLTDGQFEDLAHVIPDIISFAIGKNAVSREEYLEGRGRRYY
DVGYLRAYGHEGDPCPRCGKTFVRDTVGGRSTCWCPGCQRR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgggattccgtatcattatgccagagcttccggagatagagacggtgaggagggtc
gtcggaccacaggttgagggcaggaccttcgtgtccgtcagggccgcggacaacaggata
ctcgccaacacggaccctccgggtctatcggagcgcctgaccgggaggaccgtcgtatcg
gtcggaaggagggggaaggcgctcctgctctacgacgacctgagaggacacacggttatc
cgcttcgggatgacgggacagctgtacgtctgtcccccggataccgcggaggagagacac
acccacgaggtgttcctcctggacgacgggatggagctgaggtatgtcgacccccggcgc
ttcggacacatctggcacttccgcagggacgaggaggacacctccgggatccgcggtctg
ggactcgaaccggacgaccccggactggacgccggatatctgaaggacaggctgggaagt
aggggtatcaccgtcaaggaggggctcctcgaccagacggtggtcgccggcatcggcaac
atctggtcggacgagatgctcttcaaggcggggatatgcccgctgaccccctgcagagac
ctcaccgacggtcaattcgaggatctggcacatgtcataccggacatcatctccttcgcc
atagggaagaacgccgtgagcagggaggagtacctggagggcaggggcaggagatactac
gacgtcggatacctcagggcctacggccacgaaggggacccatgtcccagatgcgggaag
acgttcgtgagggatacggtcgggggacgcagcacctgctggtgtccaggatgtcagaga
agatga

DBGET integrated database retrieval system