KEGG   Candidatus Methanomethylophilus alvus: MMALV_16480Help
Entry
MMALV_16480       CDS       T02624                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
max  Candidatus Methanomethylophilus alvus
Brite
Enzymes [BR:max01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MMALV_16480
Transfer RNA biogenesis [BR:max03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MMALV_16480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1619687..1621222)
Genome map
AA seq 511 aa AA seqDB search
MGDDVARCIIEAIRAGDVTDRDSLQRLKMQLCSKYGPDKVPPNSEVLALVPEDERKAFLP
LLVKKPMRTASGVAVVAVMTSPYPCPHGKCAYCPGGVSNNSPQSYTGKEPAARRAAMNRF
DPYDQVSSRLAQLEEIGHDTDKIDLIIMGGTFTSRDPQYQEWFVKRCFEAMNGHPSPSLE
AAQEENSHADRRCIGLTVETRPDYFCKDIQIERMMRLGATRVELGVQILDDDVLDKVKRG
HGVSEVVKATECCRNHGLKICYHLMPGLPGSSPENDYRCFKRMFDDPDFRPDMLKFYPTL
VVGDTELHRMWEAGEYRPLDTDAAVKLLSKMKAYVPDYVRIQRIQRDIPVPEITAGILKS
NLRQLVQADMKRKGLRCRCIRCREVGHTGEVLDDPSEVRLGVEEYEANGGKERFISYTYR
DSLVGYVRLRTDDSDLATVRELKVFGNETAIGAAAESWQHRGFGKALLDEAERIARSENK
KRIRVTSGVGVREYYASRGYVLDAPYMAKDL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgacgtcgcaagatgcatcatcgaggccatcagggcgggggatgtaaccgac
cgcgactccctccagcgcctcaagatgcagctctgctccaagtacggtccggacaaagtg
ccccccaactccgaggtgctggcacttgtcccggaggacgaacgtaaggctttcctccca
ctcctcgtgaagaagcccatgaggacggccagcggagtggccgtcgtggcggtcatgacc
tccccgtatccatgtccccacggaaagtgcgcatactgtcccggaggagtatccaacaat
tcgccccaatcatatacgggaaaggaaccggcggccaggagggcggccatgaaccgcttc
gacccatatgaccaggtcagcagccgcctggcacaattggaggagatagggcacgacacc
gacaagatcgatctgataatcatgggcgggacgttcacgtccagggatccgcagtatcag
gagtggtttgtgaaaaggtgcttcgaagcgatgaacgggcacccctcccccagtctggag
gccgcacaggaagagaattcccatgcggacaggagatgcatagggctcaccgtcgagacc
cgtcccgactacttctgtaaggacatacagatcgagaggatgatgaggctcggggctacc
cgtgtggaactcggggtccagatattggacgacgacgtgttggacaaggtgaagcgcggc
cacggggtatccgaggtcgtcaaggcgacggaatgctgccgcaaccacggcctgaagatc
tgctatcatctgatgccgggtcttcccggctcgtctccggagaacgattacaggtgtttc
aagaggatgttcgacgacccggatttccgtcccgacatgctgaaattctatccgactctc
gtcgtaggtgacacggagctccatcggatgtgggaggcaggggagtataggccattggac
acggatgcggcagtgaaactcctgtcaaagatgaaggcatatgtgccagactatgtaagg
atacagcgcatacagcgcgacatcccggtcccggagatcacggcgggtatcttgaagagc
aacctccgccagctggtgcaggccgatatgaagagaaagggtctgagatgcagatgtatc
cgctgccgtgaggtcgggcacacaggggaggtcctagacgatccatccgaggtcaggctg
ggggtcgaagagtacgaggccaacggagggaaggagaggttcatatcctacacgtatcgc
gattccctggtgggctacgtccgtctcaggaccgacgattccgatctcgccaccgtgagg
gaactgaaggttttcggtaacgagaccgccataggtgctgcggccgagagctggcagcac
aggggcttcgggaaggccctcctggacgaggcggaacggatagccagatccgaaaataag
aagcgcatacgcgtgaccagcggagtgggtgtcagggaatactacgcctcccgcggttat
gtcctcgacgccccttatatggccaaggatctttga

DBGET integrated database retrieval system