KEGG   Methanosarcina barkeri: Mbar_A0022Help
Entry
Mbar_A0022        CDS       T00271                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mba  Methanosarcina barkeri
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mbar_A0022
Enzymes [BR:mba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Mbar_A0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:26763..28019
Genome map
AA seq 418 aa AA seqDB search
MNPEKCEYIVRPSRLQGKVKVSGAKNSALRLLAASLLTDEKIELTNYPANLLDAQIHVGM
LEALGKKCVVEDEKITIYEEKAPLKILNWNKRSIRNTLLILGALVSRIGEAKVPLPGGCN
LGERKFDLHEMLLRNMGAKVWIEDNMLCAKAENGLKGADIFLPIRSTGATENSMICGSLA
EGITRVWNPHIQPEILDLARFLNEMGAKIEIFGQEHIKITGVKKLFGTRHSVIADNIEAV
TWLIASVITGGDIEIIDFPFKDVEVTLIHLRQSGAKYYLGDNSLIVRGGTPYPVEISTGP
YPEIKSDVQPLFAVYGACAKGSSKIVDLRFPGRYCYTSELAKMGLQYNINGNILEIIGGN
PLNGAQVRALDLRAGIALALAGLVAKGETRILDAWQIERGYDNFVEKLISLGGNIRYG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagaaaaatgtgaatatatagtcagaccatccaggcttcaagggaaagtaaaa
gtaagtggtgcaaaaaatagtgctttacgtcttcttgcagcttcattgctaacggatgag
aaaatagaactgacaaattaccccgctaatttactcgatgctcaaattcatgttggtatg
ttggaagctcttggaaaaaaatgtgtcgtagaggatgaaaaaataaccatttacgaggaa
aaagctcctttgaaaattcttaattggaacaagcgctcaattcgtaatactttacttata
ttaggtgcactggtaagtcgcataggtgaagcaaaggttcctcttccaggaggttgtaat
cttggagaaagaaaatttgatctacacgaaatgcttctcagaaacatgggagcaaaagtt
tggattgaagataatatgctttgtgctaaagcagaaaatggactaaaaggggctgacatt
tttttacctatccgttcaacaggcgcgactgaaaattcaatgatctgtggatctttagct
gaaggtataaccagagtttggaatcctcatattcaacccgaaattcttgatttggcgcgt
tttcttaatgagatgggtgcgaagatcgagatttttggccaggaacatataaaaattact
ggagtgaaaaaattatttgggactagacattctgtaattgctgataatatcgaagcggtc
acgtggctaattgcttcagtgattacgggtggagatatcgagatcattgattttcccttc
aaggacgttgaagttacgctaatacatcttcgtcaaagcggagcgaagtattatcttgga
gacaacagtcttattgtaagagggggaaccccctatcctgtagagattagtactggtcca
tatcccgaaatcaaatcggatgttcaacctctatttgcagtttatggtgcctgtgcaaaa
ggtagttcaaaaattgttgacttacgtttccctggtagatattgttatacaagtgaacta
gccaaaatgggcttgcaatataatatcaatggtaatatattggaaatcatcggtggaaat
ccccttaatggtgctcaagtaagagctcttgatctccgagctggtattgcattagcgtta
gctggactggtggcaaaaggtgagacccggatcttagatgcctggcagattgaaagaggg
tatgataattttgtagaaaaattaatttcattggggggaaatataagatatggataa

DBGET integrated database retrieval system