KEGG   Methanosarcina barkeri Fusaro: Mbar_A0214Help
Entry
Mbar_A0214        CDS       T00271                                 

Definition
(GenBank) cellulase
Organism
mba  Methanosarcina barkeri Fusaro
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:250923..251996
Genome map
AA seq 357 aa AA seqDB search
MEKGGNLKKIKSLLEKFTNAHGISGFEDDIRKLLEKELEPYVDTMRKDCMGNLIALKKGK
GPSIMLAAHMDEIGLMVRYIDDNGFLRFVGIGGWFDQTLLNQRVVLHGKKGPIPGVIGSK
PPHVMKEDDRKKPVKLDDMFIDIGAKDREDAENLGIEIGTAVSIDRDFVPLANGKITSKA
LDNRAGVVILIEVMKRLSKHKVGANVYAVGTVQEEVGLKGARTSAFGVSPDLALALDTTI
PGDHPGITKTDSCLEIGKGPVITLADASGRGLIAHPQVIKWLKETATENKIPYQLGVGSG
GTTDATSIHLTKEGIPTGTVSIATRYIHSPVEVLDVADIDACVSLIVKAIENVGKYF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggcggaaaccttaaaaaaataaaatctctgcttgaaaaattcaccaatgct
catgggatctcaggctttgaggacgacatccgaaaactccttgaaaaggaacttgaaccc
tatgttgataccatgcgcaaagattgcatgggaaacctaatagctctcaaaaaaggaaaa
ggcccttccataatgctggctgcccatatggatgaaatcgggcttatggtcaggtatatt
gatgataatggcttcctcaggtttgtcgggatcggaggatggtttgaccagacccttctt
aaccagagagttgtacttcacggcaaaaaaggtccaattcccggagtcatcgggtccaag
cctcctcatgtaatgaaagaggatgacaggaaaaagcccgtgaagctggacgatatgttc
atcgatatcggagcaaaagacagggaagatgctgagaaccttggaattgagataggtacg
gcagtttctattgaccgggactttgtgcctctggcaaacggaaagataacttcaaaagcc
cttgacaaccgtgcaggcgttgttatccttattgaggttatgaaacggctttccaaacat
aaagttggagcaaatgtctatgccgtaggcactgtccaggaagaggtagggttaaaagga
gcaagaacctctgcctttggggtttctccagaccttgcgcttgcccttgacacaactatt
cctggagaccatccgggcattactaaaaccgattcttgcctggaaatcgggaaaggccct
gtaattacattagccgatgcgtccggaagaggccttatagctcacccacaggttattaag
tggcttaaagaaactgctactgaaaataagataccttaccagcttggcgttggttcggga
ggcacaaccgatgcaacctcaatacaccttacaaaagaaggtatccctacaggtacagtc
agcatagccacacgatacatccattcacctgttgaagtcctggatgtggcagatattgac
gcgtgcgtttcccttattgtgaaagcaatagaaaacgtaggcaaatatttctga

DBGET integrated database retrieval system