KEGG   Methanosarcina barkeri: Mbar_A0214Help
Entry
Mbar_A0214        CDS       T00271                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mba  Methanosarcina barkeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mbar_A0214
Enzymes [BR:mba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mbar_A0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:250923..251996
Genome map
AA seq 357 aa AA seqDB search
MEKGGNLKKIKSLLEKFTNAHGISGFEDDIRKLLEKELEPYVDTMRKDCMGNLIALKKGK
GPSIMLAAHMDEIGLMVRYIDDNGFLRFVGIGGWFDQTLLNQRVVLHGKKGPIPGVIGSK
PPHVMKEDDRKKPVKLDDMFIDIGAKDREDAENLGIEIGTAVSIDRDFVPLANGKITSKA
LDNRAGVVILIEVMKRLSKHKVGANVYAVGTVQEEVGLKGARTSAFGVSPDLALALDTTI
PGDHPGITKTDSCLEIGKGPVITLADASGRGLIAHPQVIKWLKETATENKIPYQLGVGSG
GTTDATSIHLTKEGIPTGTVSIATRYIHSPVEVLDVADIDACVSLIVKAIENVGKYF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggcggaaaccttaaaaaaataaaatctctgcttgaaaaattcaccaatgct
catgggatctcaggctttgaggacgacatccgaaaactccttgaaaaggaacttgaaccc
tatgttgataccatgcgcaaagattgcatgggaaacctaatagctctcaaaaaaggaaaa
ggcccttccataatgctggctgcccatatggatgaaatcgggcttatggtcaggtatatt
gatgataatggcttcctcaggtttgtcgggatcggaggatggtttgaccagacccttctt
aaccagagagttgtacttcacggcaaaaaaggtccaattcccggagtcatcgggtccaag
cctcctcatgtaatgaaagaggatgacaggaaaaagcccgtgaagctggacgatatgttc
atcgatatcggagcaaaagacagggaagatgctgagaaccttggaattgagataggtacg
gcagtttctattgaccgggactttgtgcctctggcaaacggaaagataacttcaaaagcc
cttgacaaccgtgcaggcgttgttatccttattgaggttatgaaacggctttccaaacat
aaagttggagcaaatgtctatgccgtaggcactgtccaggaagaggtagggttaaaagga
gcaagaacctctgcctttggggtttctccagaccttgcgcttgcccttgacacaactatt
cctggagaccatccgggcattactaaaaccgattcttgcctggaaatcgggaaaggccct
gtaattacattagccgatgcgtccggaagaggccttatagctcacccacaggttattaag
tggcttaaagaaactgctactgaaaataagataccttaccagcttggcgttggttcggga
ggcacaaccgatgcaacctcaatacaccttacaaaagaaggtatccctacaggtacagtc
agcatagccacacgatacatccattcacctgttgaagtcctggatgtggcagatattgac
gcgtgcgtttcccttattgtgaaagcaatagaaaacgtaggcaaatatttctga

DBGET integrated database retrieval system