KEGG   Methanosarcina barkeri: Mbar_A0230Help
Entry
Mbar_A0230        CDS       T00271                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mba  Methanosarcina barkeri
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mbar_A0230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mbar_A0230
Enzymes [BR:mba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mbar_A0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:271643..272194
Genome map
AA seq 183 aa AA seqDB search
MKIIETKIKDLYMLEPKVFEDDRGYFLESYNKKTLDSLLEKEYTFVQDNESKSSYGVIRG
LHYQLGPFSQAKLIRVVQGKVYDVAVDLRKNSPTFLDWVGVELSAENKRQFLIPKGFAHG
FSVLSETAIFQYKCDEYYHPEAEAGIIYNDSSLNIDWKIKAEDIKTSPKDLLLQKLEEAK
MNF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgaagataatagaaacaaaaataaaagatctctatatgcttgagccaaaagtatttgaa
gatgaccggggctattttcttgaaagttataataagaaaacactggacagccttttagaa
aaagaatacacttttgtccaggataatgagtcaaaatcatcttatggagtaattcgtggc
ctacactaccagctgggtccctttagtcaagcgaaacttatacgagttgtacaaggtaaa
gtctacgatgttgcagtagatctaaggaaaaattcccctacttttctggattgggttggg
gttgaactctccgctgaaaacaaaaggcagtttttaattcctaaaggctttgctcatgga
ttttccgtactgagcgaaactgccatctttcaatataaatgtgatgaatactaccatcct
gaagctgaagcagggattatctataatgactcatcattgaatattgactggaagataaaa
gctgaggatataaagacctctccgaaggatctgttactccaaaaattagaagaagctaaa
atgaatttttaa

DBGET integrated database retrieval system