KEGG   Methanosarcina barkeri Fusaro: Mbar_A0774Help
Entry
Mbar_A0774        CDS       T00271                                 

Definition
(GenBank) formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00625  Chloroalkane and chloroalkene degradation
mba00680  Methane metabolism
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
mba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mbar_A0774
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mbar_A0774
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Mbar_A0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C Pyr_redox_2 UDPG_MGDP_dh_N Shikimate_DH TrkA_N NAD_binding_7 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAZ69751
JGI: MbarA0774
UniProt: Q46EE1
Position
1:complement(937001..937882)
Genome map
AA seq 293 aa AA seqDB search
MCLTMNPDAAIANYGYPGAGPYDGGQAEYLRVPYGDWACLKLPGEPGDEFEDDFLLLSDI
FPTAYYAAELAKVKTGKTVAVFGAGPVGLLAAYSSMLKGASEVYVVDKSDKRLKLAESIG
AVPINFTDGDPVEMIMQYRQDNKKLMGSLRPGEEKALGVDCAIDAVGYQAFDRNNPEEFK
ANQVLMDIARIIAPGGSIGVIGVYSADPAGKDENEKRGYLTLPWAELWFKGVSIGTGPTP
VKQMHVFLRNLIFNDKAKPSFIVSDRISIDEAPEAYKQFDKRNDVVKPIIKFY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttactatgaatccagacgcagctatagcaaactatggatatcctggagcggga
ccatatgatggtggacaagctgagtacctgagagttccttatggagattgggcttgttta
aaattacctggtgaaccaggggatgaatttgaagacgattttttgctgctttcagatata
tttccaacagcatattatgcagcagagctagctaaagtaaaaactgggaaaacagtagct
gtttttggtgccggacctgtaggtttacttgcagcatacagttcaatgctaaaaggtgca
agtgaagtatacgttgttgataaatcagataaacgtttaaaacttgctgaatcaattggt
gcagttccaataaactttacagatggtgacccagttgagatgataatgcaataccgccaa
gataataaaaaattaatgggttctttaaggcctggagaagaaaaggctttaggtgtggac
tgtgcaattgatgcagtaggttatcaagcatttgatcgaaataatcctgaagaatttaag
gcaaatcaagttttaatggatatagcaagaattatagctcccggtggcagcattggagta
attggtgtttatagtgcagatcctgctggtaaggatgaaaatgaaaaaagaggatattta
acgcttccctgggctgaattatggttcaaaggagtatctataggtactggaccgacgcct
gttaaacaaatgcacgtgtttttaagaaatttgatattcaatgataaagcaaaaccaagc
tttatagtatctgaccgtatcagcattgatgaagctcctgaagcatataagcaatttgat
aagaggaatgatgtagttaagcctataatcaaattctattga

DBGET integrated database retrieval system