KEGG   Methanosarcina barkeri: Mbar_A0784Help
Entry
Mbar_A0784        CDS       T00271                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mba  Methanosarcina barkeri
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mbar_A0784
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A0784
  Lipid metabolism
   00071 Fatty acid degradation
    Mbar_A0784
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mbar_A0784
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mbar_A0784
   00626 Naphthalene degradation
    Mbar_A0784
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mbar_A0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(945418..946350)
Genome map
AA seq 310 aa AA seqDB search
MYVPTRTLFGAGQLNNLHTQKMPGKKAMIVISNGKSARENGYLARTEKQLKLVGIETVVF
DKVQPNPLKSTVIAGAAFAKEHGCDFIVALGGGSCMDAVKAIAIMATNDGDYWDYVFGGT
GRGKQMEHKPLSVITITTTAGTGSETDPWAVVTHEENHEKIGYGSDYLFPVLAVVDPELM
ISVPPEFTAYQGFDALFHSIEGYVSNGVNLMSDMYAITAIENISKNLAKAVKNGNDLDAR
EKVAFGNTLSGVVECVGSCTSQHSLEHAMSAYHQELPQGAGLIMLSKAYFTHLIEKHVCD
NRFVQMAQIT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtacctactcgaactttgtttggagcaggtcaattaaacaatctgcatacccag
aaaatgcctggcaagaaagctatgatcgttatctctaacggaaaatccgcaagagaaaac
ggttatcttgcaagaactgaaaagcagttgaaattagtaggaatagaaaccgtagtgttt
gacaaagttcaacccaatccattgaaatcaacggtgatagcaggcgctgctttcgcaaag
gaacatggctgcgattttattgttgctctgggtggcggaagctgtatggatgcggtaaaa
gctatcgctattatggccacaaatgatggagactattgggattatgtgtttggtggaacg
ggaagagggaagcaaatggaacataaaccactctctgttataaccattacgacaacagca
ggaacaggctccgaaactgatccttgggcagttgtaacacatgaagaaaatcacgaaaag
attggatatggtagtgactacctgtttcctgttctggcagtggtcgatcctgaacttatg
atatctgtaccacccgaatttactgcctatcagggatttgatgcattattccacagcatt
gaaggatacgtttctaacggtgtcaatcttatgagcgatatgtatgccatcactgcaata
gaaaatatctcaaaaaatcttgcaaaagcagtgaagaatggaaacgatctggatgcgcgt
gaaaaagtggcttttgggaataccctttctggtgtggttgagtgtgtagggagttgcaca
agtcagcattccctagaacatgcaatgtcagcctatcatcaggaacttccccaaggtgca
ggtcttatcatgctcagcaaggcttattttacacatctgatcgagaaacatgtatgtgat
aataggttcgtacaaatggcacagataacgtga

DBGET integrated database retrieval system