KEGG   Methanosarcina barkeri Fusaro: Mbar_A0934Help
Entry
Mbar_A0934        CDS       T00271                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbar_A0934
   01230 Biosynthesis of amino acids
    Mbar_A0934
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A0934
   00051 Fructose and mannose metabolism
    Mbar_A0934
   00562 Inositol phosphate metabolism
    Mbar_A0934
Enzymes [BR:mba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mbar_A0934
Exosome [BR:mba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mbar_A0934
  Exosomal proteins of bladder cancer cells
   Mbar_A0934
  Exosomal proteins of melanoma cells
   Mbar_A0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1132170..1132838)
Genome map
AA seq 222 aa AA seqDB search
MGLPFIVLNYKTYLQGTGQGAMEIAKACKAVSEESGVEIAVAPQLPDIYRVASEVALPVF
SQHLDGIGAGSFTGHVFGKCIKEAGAVGTLINHSEKRLTLAEIEASLKAAKEFGLRSIIC
TNNVPTTAAAAVLGPDYVAIEPPELIGSGIPVSKADPEVVSGSVEAVAKINPRVKVLCGA
GISKGEDLRAALDLGSQGVLLASGIVKATDPKAALEDLIRLI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttaccattcattgtattgaactataagacttatttacagggtacaggtcaggga
gcaatggaaattgcaaaggcctgtaaagctgtatccgaagagtcaggtgtcgagatagca
gtagccccgcagcttccggatatttacagggtagcctcggaagttgcgctcccggtcttc
tcgcagcatctggatgggataggagcaggaagcttcacaggccacgtttttggaaaatgc
ataaaagaggcaggtgctgtagggactctgatcaaccactctgaaaagcgtctgaccctt
gcagagattgaggcatcgctaaaggctgcaaaggaattcgggctcaggtcaattatctgc
actaataatgtcccgacaactgcagcagcggcagtcctggggccggattatgttgcaatc
gagcctcccgaacttatagggagcggaatccctgtctcaaaagctgaccctgaggttgtt
agcggttcggttgaggcggttgcaaaaattaatccaagggtaaaggtactctgtggagcc
gggatttccaaaggtgaagatctaagggcagctcttgaccttggttctcaaggcgtgctt
ctggcatctggaattgtgaaagccacagacccaaaagccgcacttgaagaccttatccgt
ctgatttaa

DBGET integrated database retrieval system