KEGG   Methanosarcina barkeri: Mbar_A0999Help
Entry
Mbar_A0999        CDS       T00271                                 

Definition
pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mba  Methanosarcina barkeri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mba00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mba00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mba00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mba00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mba00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mba00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mba00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1220851..1221741)
Genome map
AA seq 296 aa AA seqDB search
MSKTAPKTYITSGHSGCAGCCDAFAAKFTLMGAGPNTIVINPTGCLEVMSTPFPYSSWQV
PWIHSLFENAGAVASGVEAALKALGKKDDVKVVSIGGDGSTMDIGLGALSGAFERGHDFT
YVCMDNEAYMNTGVQRSSGTPFDASTTTTPAGKVSFGNPRPKKNMPAIMAAHGSPYVATT
SIGFPRDMIRKVKKATEIVGPTYIHAQAPCPTGWGFDTSKTLEIAKLAVETCLWPMYEME
NGEITQVRKVKNPRPVEEYLRAQKRFKHLFTMEGGEEEIKKIQAIADWNIKHFELQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactgcaccaaaaacatatatcacgtccgggcacagcggctgtgcaggttgc
tgtgatgcctttgctgcaaaattcacacttatgggagcaggcccaaatacaatcgtaatt
aacccgacgggctgccttgaagttatgtccacacctttcccatattcctcctggcaggtt
ccgtggatccactccctttttgaaaacgcaggtgcagtggcttcaggtgtggaagctgcc
ctgaaggcccttggcaaaaaagacgatgttaaagttgtgtcaattggaggagacggttct
actatggatataggcctcggtgccctttcgggtgcattcgagagaggacacgacttcacc
tatgtgtgcatggacaacgaagcatatatgaacactggagtccagcgcagcagtggaaca
ccttttgatgcaagtaccacaaccaccccagccggaaaagtttcctttggaaacccacgc
cctaagaagaacatgcctgctatcatggcagctcacggctctccttatgttgccacgacc
tctataggtttcccaagagacatgatacgaaaggtcaagaaagcaactgagatcgtggga
cctacctatatccatgcccaggccccctgtccaacaggctggggttttgatacatccaag
accctggaaattgccaaactcgcagtcgaaacatgcctttggcccatgtatgaaatggaa
aatggagaaattactcaggtcaggaaagttaagaatcccagaccagtcgaagaatacctg
agagctcagaaaaggtttaaacacctcttcaccatggaaggcggcgaggaagaaataaag
aaaatccaggctattgcagactggaacataaagcactttgagcttcagtaa

DBGET integrated database retrieval system