KEGG   Methanosarcina barkeri Fusaro: Mbar_A1002Help
Entry
Mbar_A1002        CDS       T00271                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba00020  Citrate cycle (TCA cycle)
mba00620  Pyruvate metabolism
mba00633  Nitrotoluene degradation
mba00640  Propanoate metabolism
mba00650  Butanoate metabolism
mba00680  Methane metabolism
mba00720  Carbon fixation pathways in prokaryotes
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01200  Carbon metabolism
Module
mba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A1002
   00020 Citrate cycle (TCA cycle)
    Mbar_A1002
   00620 Pyruvate metabolism
    Mbar_A1002
   00640 Propanoate metabolism
    Mbar_A1002
   00650 Butanoate metabolism
    Mbar_A1002
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbar_A1002
   00680 Methane metabolism
    Mbar_A1002
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mbar_A1002
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mbar_A1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AAZ69970
JGI: MbarA1002
UniProt: P80523
Position
1:complement(1223230..1223778)
Genome map
AA seq 182 aa AA seqDB search
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRINNNPIRL
RSQVYTPDYVIVQDATLLETVDVASGVKDDGIIIVNTTENPESLKLNTKARVMTVDATKV
AMDIIGVPIVNTVLLGAFAGATGEINVESIQHAIRARFSGKVGEKNANAIQKAYKLIRGE
EA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatcagaatacacggtcgaggaggccagggttctgttaccgcggctgaaatg
ctttccgttgcagcttttgaagatggaaagttcagccaggccttccccgcttttggggta
gagcgtagaggtgccccagtccaggcattcacgaggattaacaacaatcctatcaggctc
cgaagtcaggtttacaccccggattatgttattgtccaggacgcaaccctgcttgaaact
gttgacgttgcaagtggagtaaaggatgatggaataattattgttaacacaaccgaaaac
ccggaaagcctgaaactcaatacaaaagctagggtcatgaccgtggacgctaccaaggtg
gcaatggacataataggtgttcccattgtaaatactgttctccttggagcttttgcgggt
gcaaccggagaaatcaatgttgaatcaattcagcatgcaataagggctcgtttttcaggc
aaagtcggagaaaagaatgcaaatgcaattcagaaggcctacaagcttatcaggggggaa
gaagcgtga

DBGET integrated database retrieval system