KEGG   Methanosarcina barkeri: Mbar_A1121Help
Entry
Mbar_A1121        CDS       T00271                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mba  Methanosarcina barkeri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mbar_A1121
   00052 Galactose metabolism
    Mbar_A1121
   00500 Starch and sucrose metabolism
    Mbar_A1121
   00520 Amino sugar and nucleotide sugar metabolism
    Mbar_A1121
Enzymes [BR:mba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mbar_A1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1378011..1378898)
Genome map
AA seq 295 aa AA seqDB search
MTVKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIQYVVEEAIASGIEDIIIITGRGK
RAIEDYFDDSPELEMHLAKKHNTELLKLVRNVSSLVDIHYIRQKEPNGLGDAVLRAENHI
GDEPFAVLLGDDIIVNNKPCTAQLIDNFEKYGRSTLAVEEVPREKLSSYGIIKGKPLSNS
LYVLEDIVEKPSPENAPSNMGAIGRYVFTPEIFDCIKEAGTGVGNEIQLTDGIRVLNRSQ
MIYACRFKGKRFDTGDRLGYVKSIVDFALENENLREDVLEYLREILAEVKEPSSK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgttaaaaaagcacttattccggcagctggtcttgggacccgtttccttcctgcc
accaagtcaatgccaaaagagatgcttcctattattgacacacctgtgattcaatatgtt
gtagaggaagccattgcctcgggaattgaggatataatcattatcacaggcaggggtaaa
cgggcaattgaagattatttcgatgattctcctgaactcgaaatgcatcttgcgaaaaag
cacaataccgaacttcttaaacttgtcaggaatgtttcttcccttgtggatattcactat
atccgccagaaagaacctaacgggctcggggatgcagttctcagggcagaaaaccacatt
ggagacgaacctttcgccgtgcttcttggagacgatattattgtgaataacaagccctgc
actgcccaactcatagataattttgagaaatatgggaggtccacgcttgcagtggaagaa
gtccctcgtgaaaaattaagtagttatggaattataaagggcaagcctcttagtaattct
ctctatgtactggaggacattgttgaaaaaccgtcacctgaaaatgctccctcaaatatg
ggagcaataggccgctatgttttcacccctgaaatatttgactgtataaaagaagccggg
acaggggtaggaaacgaaatccagttgactgatgggattcgggttcttaacaggtcacag
atgatatacgcatgcaggttcaaaggaaaaagattcgatactggcgacaggttagggtac
gtgaaatcaatagtagattttgcccttgaaaacgaaaaccttagagaagacgtacttgag
tacttaagagaaatcctagcagaggtaaaggaaccttcaagcaaataa

DBGET integrated database retrieval system