KEGG   Methanosarcina barkeri: Mbar_A1168Help
Entry
Mbar_A1168        CDS       T00271                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mba  Methanosarcina barkeri
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mba00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mba00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1434324..1435250)
Genome map
AA seq 308 aa AA seqDB search
MSFKNRNVISMKDFSRKEINYILDTAEKLEPVARGKKRSRLLDGKIIALLFFEPSTRTRL
SFESAAQRLGGQVLNLGSVEASSVMKGENLADTIRVISKYADLIVLRHPLDGSARMAAEF
ASVPIINGGDGSLHHPTQTFLDLYTIRRESHLEGLKIAMAGDLKYGRTVHSLCHALSLYG
AEITLVSPPELRMPQEIIRDLQKNNIRIRETDALEEIIGDVEVLYMTRVQRERFPDPEEY
EKVKNKLKVTGDLLKNADPSLKILHPLPRVNEISPEVDSTPYACYFEQAFYGVPTRMALL
ALATGVIE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaagaacagaaacgtcatttctatgaaggacttttcgcggaaagaaatcaat
tacattctggatacggcagaaaagcttgaacctgtggccagaggtaaaaagaggtcccgg
ttgctggatggaaaaataatagctcttcttttttttgaaccaagcacaaggacaaggctg
tcttttgaatctgctgcgcagagacttggagggcaggttctcaacctgggttctgtggaa
gcaagttcagtaatgaaaggagaaaatcttgccgatactattcgcgtaatcagcaaatat
gcagatcttattgttttgcgtcatcctcttgatggttcggcacgaatggctgcggaattt
gcaagtgttcctataatcaatggtggagacggctctttacaccaccctacacaaactttc
cttgacctctataccattcgcagggaaagccacctagaaggtctgaagatcgctatggca
ggagatctgaagtatggaagaacagttcattccctgtgtcatgccctatccctgtacgga
gctgaaattaccttagtttcgcctcctgaactccggatgccccaggagattatcagggat
cttcaaaagaacaatattcgaattagagaaaccgatgctcttgaagaaataattggagac
gtcgaggttctttatatgacaagggttcaaagggaacgtttccctgatcctgaagagtat
gaaaaggtcaaaaacaagttgaaggttacaggtgacctactgaaaaacgcagatcctagc
cttaagattcttcatcccctcccacgggtcaacgaaatctctcctgaagtggattcaaca
ccatatgcatgttatttcgagcaggctttttatggggttcctacgcggatggcacttctt
gctcttgctacgggagtgattgaatga

DBGET integrated database retrieval system