KEGG   Methanosarcina barkeri: Mbar_A1463Help
Entry
Mbar_A1463        CDS       T00271                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mba  Methanosarcina barkeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mbar_A1463
Enzymes [BR:mba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mbar_A1463
Exosome [BR:mba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mbar_A1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1797260..1798234
Genome map
AA seq 324 aa AA seqDB search
MFPDVRLRRLRKGKIRNLVRETTLSVDDLVQPIFVNETIDSAVEIPSMPGIYNIPLSEVV
NEAKEIAELGIPAVIIFGVPAFKDAEGSSAYGETDVVQEAVRRIKAELGDELVVITDVCM
CEYTSHGHCGIVDFETKEILNDPTIEVIGKIAVSHAKAGADMVAPSCMMDGMVEAIRQAL
DMNGFENIPIMSYAAKYHSCFYGPFREAAESGYSFGDRSTYQMDPANSDEAIREVTLDVA
EGADIIIVKPALPYLDIIYRVKTDYGMPTAAYNVSGEYSMIKAAAANGWLDEKKAIYESL
ISIKRAGADIIITYFAKDAARMLK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagatgtcaggttaagacgattgagaaaaggaaagatcaggaaccttgtgcgt
gaaactaccttatccgtagacgacctggtccagcccatttttgtgaatgagactattgat
tctgctgttgaaattccttccatgcccggaatatacaatattcctctctctgaggttgta
aatgaggcaaaagagattgcagaactcgggattccggcagtgatcattttcggagtgcct
gcattcaaagacgcagaaggcagttctgcatatggggaaaccgatgttgtccaggaggct
gtcaggagaattaaggccgagcttggagacgaacttgtggtgatcacggacgtctgcatg
tgtgaatacacaagccatggacactgcggaattgttgatttcgaaacgaaagaaatcctg
aatgaccccaccattgaggtcatcggaaagattgcagtgagccatgcaaaggcaggagct
gatatggtagctccgtcgtgtatgatggatggaatggtagaagccatcagacaagcgctt
gatatgaacggatttgagaatattccgatcatgtcctatgccgcaaaatatcattcgtgt
ttctatgggcctttcagagaagccgctgagtcaggatattccttcggagaccgttctacc
tatcaaatggatcccgcaaacagcgacgaggctatcagggaagtaactcttgatgtggct
gaaggcgcagatataattattgtaaagccagctcttccttaccttgatattatctacagg
gtcaagacggattatgggatgccaactgctgcatacaacgtaagcggagaatattccatg
atcaaagccgccgcagctaacggctggcttgacgaaaagaaagcaatttacgaatccctc
atctctatcaaaagggcaggagccgatattatcattacttactttgcaaaagatgctgcc
cgcatgttgaagtaa

DBGET integrated database retrieval system