KEGG   Methanosarcina barkeri Fusaro: Mbar_A1517Help
Entry
Mbar_A1517        CDS       T00271                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mba  Methanosarcina barkeri Fusaro
Brite
Enzymes [BR:mba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mbar_A1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Fibrillarin Methyltransf_3 RrnaAD Methyltransf_25 Methyltransf_23 Ubie_methyltran Methyltransf_24 Methyltr_RsmB-F CMAS Methyltransf_11 MTS ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAZ70469
JGI: MbarA1517
UniProt: Q46CC3
Position
1:complement(1874611..1875090)
Genome map
AA seq 159 aa AA seqDB search
MNSEEGRGKEKDNREKEEEKLEAMRRYLVDNLEAYLLLKDNVREAMLRVPRHKFVPEYEQ
KAAYMDRPLDIGHGQTISAPHMVAMMCELLELSEGHKVLEIGTGSGYNAAVMGELVGKSG
HVYTVERIEVLANFARENLKKAGYNNVTVLLEDGSMGYS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccgaagagggccgtggtaaagaaaaagataacagggaaaaagaggaagaaaaa
ctcgaagcaatgcgcaggtacctcgtagacaatcttgaggcttacctgctactgaaagat
aacgttcgcgaggctatgctccgtgtcccaaggcataagtttgttccggaatatgagcaa
aaagcagcttatatggacagaccccttgacatcggccacgggcaaacaatctctgccccg
catatggttgcgatgatgtgtgaactccttgaactttcggaagggcataaagtcctggag
attggaacaggttcagggtataatgctgcagtgatgggggaactcgtaggaaaaagcggg
cacgtgtacacggttgaacgtatagaagtccttgcgaattttgcaagggagaacctgaaa
aaagcaggatataacaatgttacagtgctacttgaagacggttcaatgggttattcttag

DBGET integrated database retrieval system