KEGG   Methanosarcina barkeri: Mbar_A1755Help
Entry
Mbar_A1755        CDS       T00271                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mba  Methanosarcina barkeri
Brite
Enzymes [BR:mba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mbar_A1755
Transfer RNA biogenesis [BR:mba03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mbar_A1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2150369..2152012)
Genome map
AA seq 547 aa AA seqDB search
MKEDDYNKACREILEKVLAGEIENENQLNKAKKDVSKQYHLASLPRNGDVITQGSDEEQA
VIKDFLKRKPVRTISGVAAIAVMTSPAPCPHGVCLPCPGGPKSAFKSPQSYMGREPAAMR
AIQHGFDPYSQVESRLFQLKEIGHDVEKVELIVMGGTFSARNLDYQEWFIKRCLEAMNDF
TGKEWREKAWRIGKSLPYIPLEEVQKANEKAEIRNVGITFETRPDWAGEKHVDEFLKLGG
TKVELGVQSVYDFVLTRMQRGHGVAEIVRANQILRDSAFKVGFHMMPHLPGSDSELDLKG
FKKLFEDPRFKPDYLKIYPTLVTEGTPLCRLWEAGDYEALSDEEAAELIADIKEILPKWV
RLQRIQRDIPAYQIIAGVRKSNLRQLAEEKLRERGGKCHCIRCREVGHTSLKGRKINPKD
IELTVESYEACGGTEHFIAFEDLAADVLIGFTRLRFPATPHRPELQDAALIRELHVYGSM
VPIGKEAKQKEWQHRGYGKELLEYAEKMARENGYRKLAIISGIGAREYYRKFGYALDNVY
MSKVLKD
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagatgattataataaggcctgcagggaaatccttgaaaaagtacttgccggc
gagatagaaaacgaaaaccagttaaataaggcaaaaaaagatgtcagtaaacagtatcat
ctggccagcctccccagaaatggagatgtcataacccagggatcggacgaagagcaggca
gtaattaaagattttttgaaacggaagcctgtaagaacgatttctggagttgcggcaatt
gctgtaatgacatctccggccccatgccctcatggagtttgtcttccctgcccaggagga
cctaaatctgcgttcaagtcgccccagagttatatgggaagagagcctgcagccatgagg
gcgatccagcatggatttgacccttattcccaggttgaatccaggcttttccagcttaaa
gagatcggccatgatgtagagaaagtggaactgatagtgatgggaggtacgttttctgca
cgcaatctcgattaccaggaatggtttattaaacgctgccttgaggcaatgaacgatttc
acaggtaaagagtggagagaaaaagcctggagaattgggaaatctttaccttatatccct
cttgaagaggtgcagaaagccaatgaaaaagctgaaattcgcaacgtaggaatcacattc
gaaacgcgtcctgactgggcaggagagaaacatgtggacgaattcctcaaactcggagga
actaaggtagaactcggggttcagagtgtttatgattttgtgctcacccgtatgcaaaga
gggcacggagttgcagaaattgtcagggctaatcagatattaagagacagcgcattcaaa
gttggatttcatatgatgcctcacctacctggctcggattcagagctggacctcaaaggt
ttcaaaaagctcttcgaagatcctcgctttaagcccgattatctcaaaatttatcctacc
ttagtaactgaaggaactcctctttgcaggctttgggaagcaggagattacgaagctctt
tctgacgaagaagctgctgaactaattgcagatataaaagagatcctacctaaatgggtc
agactccagcgtatccaacgagatattccagcttaccagatcattgccggggtccgaaag
agcaatctcaggcagcttgcagaagaaaagctgagagaaagaggaggaaagtgccactgt
attcgctgcagggaagtaggacatactagcctgaaagggagaaaaataaatccaaaggat
atcgaactgactgtagagagttacgaagcttgcggaggcacagagcatttcatcgcgttt
gaagatcttgccgcagatgtcctgattggatttacccgtttgcgcttccctgctacccct
catcgccctgaactgcaagatgccgccctgataagagaactgcacgtttacggttcaatg
gtacctataggaaaagaagcaaagcaaaaggagtggcaacatagaggatatggcaaggaa
cttctagaatatgcagagaagatggcacgtgaaaatgggtaccggaaacttgccatcatc
agtgggataggagccagagagtactatcgaaaatttgggtatgcccttgataacgtatat
atgtcaaaggttttgaaagattaa

DBGET integrated database retrieval system