KEGG   Methanosarcina barkeri: Mbar_A1792Help
Entry
Mbar_A1792        CDS       T00271                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mba  Methanosarcina barkeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2208474..2209265
Genome map
AA seq 263 aa AA seqDB search
MAEEKRPVLAIMRPESYREKSEALAQDYGFEPLYVPMIRLEGIKDEGFEPFIRRVLTGSS
DYVVFTSANGISFTLDKLSETEKKDFITALKKIKVIAIGPNTEKELIKIGIDNSFLPGDY
SSKGIVEALCPEVAGKTVDLARSAFGAKVLIEGLEKCGATVYETHVYTLSIPEGTIQKDL
IERTLAGEVDAFAFTSSMMVKGFMKHAKGLGAEETIKESLSRAVVGAIGTPTGNTLNKYG
VNANVIPEEFTFEALIKAMKKEL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaaaaaggcctgttctcgcaattatgaggccggaaagctacagggaaaaa
tcagaggctcttgcgcaagattatggttttgagcctttatacgttcctatgattcggctt
gaaggcataaaagatgaaggttttgagccctttatccgaagagtccttacaggatcttcg
gattatgttgtttttaccagtgcaaacggaataagttttactctggacaagctctctgaa
actgaaaagaaggatttcattacagcgcttaaaaaaatcaaggtaattgccatcgggcct
aatacggaaaaggaactcataaagataggaattgacaactcatttttgccgggagattat
agctccaaaggaattgtagaagctctctgccccgaggtggcaggaaagacggtagacctt
gccaggagtgcttttggggctaaggtcttaatagaagggcttgaaaagtgtggagctacg
gtttatgagactcacgtgtacactctcagcattcctgaaggaacgatccagaaagatttg
atagagcgcacgctcgcaggggaagtggatgcttttgcttttacaagttcgatgatggtt
aaaggctttatgaaacatgcaaaagggctgggagcagaggaaaccataaaagaatctctc
agcagggctgtggtaggagctataggaacgcctacaggaaataccctgaacaaatatggt
gtcaatgcgaacgtaatccctgaagagtttactttcgaagctctgataaaggctatgaaa
aaagagctatga

DBGET integrated database retrieval system