KEGG   Methanosarcina barkeri Fusaro: Mbar_A2049Help
Entry
Mbar_A2049        CDS       T00271                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbar_A2049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A2049
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mbar_A2049
Enzymes [BR:mba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mbar_A2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2590508..2591725)
Genome map
AA seq 405 aa AA seqDB search
MYHLKCIECGAEYSKDEVIYTCSKCDGLLDVIYDYSSVKIDMEKLKTECPSVWKYAKLLP
IEREPVTIQEGGTPLYKCNRLAEKIGIKELYVKHEGMNPTGSFKDRGMTVGVTKALELGM
NTVACASTGNTSAALAIYGAKAGIPVIVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA
LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLGFKVPDRVVLPVGNAGNITAIW
KGFREFKKLGITDSLPKMTGIQAAGSCPIVTAIKSEAPEITPEEKPETVATAIRIGNPVN
AKKALAAIRESGGTAESVTDEEILTAQKDLARLEGIGVEPASAASVAGLKKLVDMGVISR
DETVVCITTGHLLKDPQTVIDICEKPIVVDASIEAIREAIFGKAE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctcaaatgtatcgaatgcggtgcagagtattccaaagacgaagtaatctat
acatgcagcaaatgtgatgggctgcttgatgtaatttatgattattcctcagtaaaaatt
gacatggaaaaactgaagactgaatgcccttcggtctggaaatatgcaaaacttctccct
attgaaagagagcctgtaactatccaggaaggcggaactcccctttacaaatgcaaccgt
ctggctgagaaaatcggaattaaagaactctacgtgaagcacgaaggcatgaaccctaca
ggctcttttaaggacagaggaatgactgtaggagttacgaaagcacttgaattgggaatg
aacaccgttgcctgtgcgtctactggaaatacctcggcagcccttgcaatctatggggca
aaagccggaattcctgtaatcgtacttttgcctgcaggaaaagttgctcttggaaaagta
gcccaggcccttatgcacggagcaaaggtcctcagcattcgtggaaattttgacgacgct
ctcgcccttgtgcgcactctctgttcccaggaaaaaatctatctcttaaactcgatcaac
ccctacaggctggaaggccagaagactatcggttttgaaattgcagaccagctcggtttc
aaagtacctgacagagttgtcctgcctgtaggaaatgcaggaaatatcacagctatctgg
aagggtttcagggagtttaagaagctcggcataacggattcgctcccgaagatgaccggg
attcaggccgcaggctcctgtccaattgtaacagctataaagagcgaggctcctgaaatc
acccctgaggaaaaacccgaaaccgttgcaacagcaatcaggataggaaaccctgttaac
gctaaaaaggctcttgctgccatccgggaatccggtgggactgcggaatccgttactgac
gaagaaatccttacagcccagaaagaccttgcaaggcttgaaggaataggtgtcgaacct
gcaagtgcagcttcggttgcagggcttaagaaacttgttgatatgggtgttataagcaga
gacgagaccgttgtctgtattactacaggacacctgcttaaagacccgcagactgtaatt
gacatctgtgaaaaacctattgttgtggatgccagtatagaagccatccgggaagctatc
ttcggaaaggcagaataa

DBGET integrated database retrieval system