KEGG   Methanosarcina barkeri: Mbar_A2172Help
Entry
Mbar_A2172        CDS       T00271                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mba  Methanosarcina barkeri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mba00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mba00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mba00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mba00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2747231..2748910
Genome map
AA seq 559 aa AA seqDB search
MTSLLNQFVSKTDFESYEDFETNFKILVPENFNFAYDIVDVYARDFPEKIAMIWCDDHGE
ERIFTFKDLKYYTDKTANFFAKHGIGKGDYVMLTLKSRYEFWYCIIALHKLGAIAVPATH
MLKTRDIVYRIKKAGLKMIVCISENGVPEQIDEAHSECGNVPLKKAVVGENVREGWIDFR
KELEEASPDFERPSGEAATKNSDISLAYFSSGTASFPKMVEHDFTYPLGHILTAKYWQNV
EDDGLHYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKATKYGVTTFCAP
PTIYRFLIKEDLSKYNFSTVKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTESVVTIA
TYPWMEPKPGSIGKPSPGFKIELMDRDGRLCEVGEEGEIVINTKEGKPVGLFVHYGKDPE
KTKKAWHDGYYHTGDMAWKDEDGYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAVLEC
AITGAPDPIRGQVIKATVVLTKGYTPGEELKKELQKHVKSVTAPYKYPRIIEFVDELPKT
ISGKIRRVEIRDKDQSELQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttactcaaccagtttgtttctaaaaccgactttgaatcttatgaggatttt
gagacaaatttcaaaatccttgttcctgaaaacttcaactttgcctatgatatagtcgat
gtctatgcaagagatttccctgagaagatcgcaatgatctggtgtgacgatcatggggaa
gagagaatctttacgttcaaagacctgaagtactacactgacaaaactgcaaatttcttt
gcaaagcatggtatcggtaaaggcgactatgtaatgctcactttaaagagccggtacgag
ttctggtactgtatcattgcactgcataaattgggagccattgctgtacccgcaacccat
atgctcaagacacgagatattgtataccggattaaaaaagcaggactgaagatgatcgtc
tgcatctcggaaaatggagttccagaacagatagacgaagcacactccgaatgcggaaat
gtcccgctcaagaaagcagtagttggagaaaatgtccgggaaggctggattgatttcagg
aaagaactcgaagaagcttcccctgattttgaacggccttcgggcgaagctgctacgaaa
aatagtgatatttctctcgcttatttctcttcaggaacagctagcttcccaaaaatggtg
gaacatgactttacttatccccttgggcatatcctcactgcaaagtactggcagaacgtg
gaagatgacgggctgcattatacggttgcagacagcggatgggggaaatgcgtatgggga
aaactctatgggcagtggatagccggttgtgcggtctttgtctatgattatgatcggttt
gaagccaaaaatatgctggaaaaagccacgaaatacggggttacaaccttctgcgccccg
ccaaccatctaccgttttctgatcaaggaagatctctcaaagtacaatttcagtaccgtg
aaatatgcagtcgttgcaggcgaacctcttaatcctgaggtattcaacaggttccttgaa
tttacaggaataaagcttatggaagggttcggacagactgaatccgttgtaactatcgca
acgtacccctggatggaaccgaaaccaggatctattgggaaaccatctccgggctttaaa
attgaactgatggacagagacggcagactttgtgaggtaggggaagaaggagaaatcgta
atcaacacaaaggaaggcaagcctgtcggactcttcgtacactacgggaaagatcctgag
aaaactaagaaagcatggcacgatggttattatcataccggagatatggcctggaaagac
gaagacggctatctgtggtttgtcggaagagctgatgatatcataaaaacctcgggatat
aaagtcgggccttttgaagtggaaagtgctcttatccaacaccctgcagtactcgaatgc
gcaattacaggtgcacctgatcctataagaggacaggttatcaaggcaaccgttgtgctc
acaaaaggatatacgcctggagaagaacttaaaaaagagcttcagaaacacgtaaaaagt
gtcaccgctccctacaagtatccgcgcataatcgaatttgtggacgagcttccaaagacc
attagcggaaaaattcgcagggtcgagatccgtgataaagatcaaagcgaactacagtga

DBGET integrated database retrieval system