KEGG   Methanosarcina barkeri Fusaro: Mbar_A2172Help
Entry
Mbar_A2172        CDS       T00271                                 

Definition
(RefSeq) AMP-binding protein
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbar_A2172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2172
   00620 Pyruvate metabolism
    Mbar_A2172
   00640 Propanoate metabolism
    Mbar_A2172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbar_A2172
   00680 Methane metabolism
    Mbar_A2172
Enzymes [BR:mba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mbar_A2172
Lipid biosynthesis proteins [BR:mba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mbar_A2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2747231..2748910
Genome map
AA seq 559 aa AA seqDB search
MTSLLNQFVSKTDFESYEDFETNFKILVPENFNFAYDIVDVYARDFPEKIAMIWCDDHGE
ERIFTFKDLKYYTDKTANFFAKHGIGKGDYVMLTLKSRYEFWYCIIALHKLGAIAVPATH
MLKTRDIVYRIKKAGLKMIVCISENGVPEQIDEAHSECGNVPLKKAVVGENVREGWIDFR
KELEEASPDFERPSGEAATKNSDISLAYFSSGTASFPKMVEHDFTYPLGHILTAKYWQNV
EDDGLHYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKATKYGVTTFCAP
PTIYRFLIKEDLSKYNFSTVKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTESVVTIA
TYPWMEPKPGSIGKPSPGFKIELMDRDGRLCEVGEEGEIVINTKEGKPVGLFVHYGKDPE
KTKKAWHDGYYHTGDMAWKDEDGYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAVLEC
AITGAPDPIRGQVIKATVVLTKGYTPGEELKKELQKHVKSVTAPYKYPRIIEFVDELPKT
ISGKIRRVEIRDKDQSELQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttactcaaccagtttgtttctaaaaccgactttgaatcttatgaggatttt
gagacaaatttcaaaatccttgttcctgaaaacttcaactttgcctatgatatagtcgat
gtctatgcaagagatttccctgagaagatcgcaatgatctggtgtgacgatcatggggaa
gagagaatctttacgttcaaagacctgaagtactacactgacaaaactgcaaatttcttt
gcaaagcatggtatcggtaaaggcgactatgtaatgctcactttaaagagccggtacgag
ttctggtactgtatcattgcactgcataaattgggagccattgctgtacccgcaacccat
atgctcaagacacgagatattgtataccggattaaaaaagcaggactgaagatgatcgtc
tgcatctcggaaaatggagttccagaacagatagacgaagcacactccgaatgcggaaat
gtcccgctcaagaaagcagtagttggagaaaatgtccgggaaggctggattgatttcagg
aaagaactcgaagaagcttcccctgattttgaacggccttcgggcgaagctgctacgaaa
aatagtgatatttctctcgcttatttctcttcaggaacagctagcttcccaaaaatggtg
gaacatgactttacttatccccttgggcatatcctcactgcaaagtactggcagaacgtg
gaagatgacgggctgcattatacggttgcagacagcggatgggggaaatgcgtatgggga
aaactctatgggcagtggatagccggttgtgcggtctttgtctatgattatgatcggttt
gaagccaaaaatatgctggaaaaagccacgaaatacggggttacaaccttctgcgccccg
ccaaccatctaccgttttctgatcaaggaagatctctcaaagtacaatttcagtaccgtg
aaatatgcagtcgttgcaggcgaacctcttaatcctgaggtattcaacaggttccttgaa
tttacaggaataaagcttatggaagggttcggacagactgaatccgttgtaactatcgca
acgtacccctggatggaaccgaaaccaggatctattgggaaaccatctccgggctttaaa
attgaactgatggacagagacggcagactttgtgaggtaggggaagaaggagaaatcgta
atcaacacaaaggaaggcaagcctgtcggactcttcgtacactacgggaaagatcctgag
aaaactaagaaagcatggcacgatggttattatcataccggagatatggcctggaaagac
gaagacggctatctgtggtttgtcggaagagctgatgatatcataaaaacctcgggatat
aaagtcgggccttttgaagtggaaagtgctcttatccaacaccctgcagtactcgaatgc
gcaattacaggtgcacctgatcctataagaggacaggttatcaaggcaaccgttgtgctc
acaaaaggatatacgcctggagaagaacttaaaaaagagcttcagaaacacgtaaaaagt
gtcaccgctccctacaagtatccgcgcataatcgaatttgtggacgagcttccaaagacc
attagcggaaaaattcgcagggtcgagatccgtgataaagatcaaagcgaactacagtga

DBGET integrated database retrieval system