KEGG   Methanosarcina barkeri Fusaro: Mbar_A2172Help
Entry
Mbar_A2172        CDS       T00271                                 

Definition
(GenBank) AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba00620  Pyruvate metabolism
mba00640  Propanoate metabolism
mba00680  Methane metabolism
mba00720  Carbon fixation pathways in prokaryotes
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01200  Carbon metabolism
Module
mba_M00357  Methanogenesis, acetate => methane
mba_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2172
   00620 Pyruvate metabolism
    Mbar_A2172
   00640 Propanoate metabolism
    Mbar_A2172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbar_A2172
   00680 Methane metabolism
    Mbar_A2172
Enzymes [BR:mba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mbar_A2172
Lipid biosynthesis proteins [BR:mba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mbar_A2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAZ71100
JGI: MbarA2172
UniProt: Q46AJ2
Position
1:2747231..2748910
Genome map
AA seq 559 aa AA seqDB search
MTSLLNQFVSKTDFESYEDFETNFKILVPENFNFAYDIVDVYARDFPEKIAMIWCDDHGE
ERIFTFKDLKYYTDKTANFFAKHGIGKGDYVMLTLKSRYEFWYCIIALHKLGAIAVPATH
MLKTRDIVYRIKKAGLKMIVCISENGVPEQIDEAHSECGNVPLKKAVVGENVREGWIDFR
KELEEASPDFERPSGEAATKNSDISLAYFSSGTASFPKMVEHDFTYPLGHILTAKYWQNV
EDDGLHYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKATKYGVTTFCAP
PTIYRFLIKEDLSKYNFSTVKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTESVVTIA
TYPWMEPKPGSIGKPSPGFKIELMDRDGRLCEVGEEGEIVINTKEGKPVGLFVHYGKDPE
KTKKAWHDGYYHTGDMAWKDEDGYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAVLEC
AITGAPDPIRGQVIKATVVLTKGYTPGEELKKELQKHVKSVTAPYKYPRIIEFVDELPKT
ISGKIRRVEIRDKDQSELQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttactcaaccagtttgtttctaaaaccgactttgaatcttatgaggatttt
gagacaaatttcaaaatccttgttcctgaaaacttcaactttgcctatgatatagtcgat
gtctatgcaagagatttccctgagaagatcgcaatgatctggtgtgacgatcatggggaa
gagagaatctttacgttcaaagacctgaagtactacactgacaaaactgcaaatttcttt
gcaaagcatggtatcggtaaaggcgactatgtaatgctcactttaaagagccggtacgag
ttctggtactgtatcattgcactgcataaattgggagccattgctgtacccgcaacccat
atgctcaagacacgagatattgtataccggattaaaaaagcaggactgaagatgatcgtc
tgcatctcggaaaatggagttccagaacagatagacgaagcacactccgaatgcggaaat
gtcccgctcaagaaagcagtagttggagaaaatgtccgggaaggctggattgatttcagg
aaagaactcgaagaagcttcccctgattttgaacggccttcgggcgaagctgctacgaaa
aatagtgatatttctctcgcttatttctcttcaggaacagctagcttcccaaaaatggtg
gaacatgactttacttatccccttgggcatatcctcactgcaaagtactggcagaacgtg
gaagatgacgggctgcattatacggttgcagacagcggatgggggaaatgcgtatgggga
aaactctatgggcagtggatagccggttgtgcggtctttgtctatgattatgatcggttt
gaagccaaaaatatgctggaaaaagccacgaaatacggggttacaaccttctgcgccccg
ccaaccatctaccgttttctgatcaaggaagatctctcaaagtacaatttcagtaccgtg
aaatatgcagtcgttgcaggcgaacctcttaatcctgaggtattcaacaggttccttgaa
tttacaggaataaagcttatggaagggttcggacagactgaatccgttgtaactatcgca
acgtacccctggatggaaccgaaaccaggatctattgggaaaccatctccgggctttaaa
attgaactgatggacagagacggcagactttgtgaggtaggggaagaaggagaaatcgta
atcaacacaaaggaaggcaagcctgtcggactcttcgtacactacgggaaagatcctgag
aaaactaagaaagcatggcacgatggttattatcataccggagatatggcctggaaagac
gaagacggctatctgtggtttgtcggaagagctgatgatatcataaaaacctcgggatat
aaagtcgggccttttgaagtggaaagtgctcttatccaacaccctgcagtactcgaatgc
gcaattacaggtgcacctgatcctataagaggacaggttatcaaggcaaccgttgtgctc
acaaaaggatatacgcctggagaagaacttaaaaaagagcttcagaaacacgtaaaaagt
gtcaccgctccctacaagtatccgcgcataatcgaatttgtggacgagcttccaaagacc
attagcggaaaaattcgcagggtcgagatccgtgataaagatcaaagcgaactacagtga

DBGET integrated database retrieval system