KEGG   Methanosarcina barkeri: Mbar_A2183Help
Entry
Mbar_A2183        CDS       T00271                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mba  Methanosarcina barkeri
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2763348..2766290
Genome map
AA seq 980 aa AA seqDB search
MDESPKKDFPIVGIGASAGGLAAFEAFFSAMPSDADPGAAFVLIQHLDPNSKSILSDLIR
NFTRMPVYEATNWINIEPNCVYIIPPNCDMVLRDGVLQLMEPSQPHGYRLPIDIFFSSLA
QDKKEKAIGIVLSGTGSDGTKGVQTIKDEGGMVMAQAPESSEYNNMPLSAIATGQVDYVL
KPEEMPAQLIAYITYVFGKTRQVTLKFESLMKNIFNFLHIKTGHDFSNYKYGTINRRVER
RMAVRNIDNVNEYVRYLEQKPDEVEALFHDLLIGVTSFFRNPEAYEALQKRVIPCLFAGK
YPESSIRVWVPGCSTGEEAYSIAILLQEQMDNLDQNFKVQIFATDIDSKAIEKARSGIYP
ANIAADMSSKRLKRFFTLDSDGYYHIQHNIREMVIFSEQDIIKDPPFSKLDLISCRNLLI
YMDKELQKKLIPLFHYALNPGGFLFLGPSENVGEFTNLFDTLDRKSKLYIKKGGASSEYF
LSIGTFISPSMKSEARKPSGNVPVEIRPKLRELTEQAMLQYYAPVSVLIDEHGNILYIYG
RTGMYLEPASGEVGMNILSMAREGLRSKLTTALHRAVIDKAPVFHPRVRVKTNGDFTTIN
LAIRPVERNHGTATWLNLFLVTFEETTESEQIKTEKAISIDASEKACDKDLDVRILKLKK
ELQAKEESLKASNEELATSNEELKSANEEMQSVNEELQSTNEELETSREELQSVNEELGT
VNIELQNRVAELSQANNDMNNLLAGTGIGTIFVDHQLRIMRFTPPVTRLINLIPSDIGRP
VGHIVSNLLGYDRLVEDIKEVLDSLIPKDIEVQTKENTWYLLGIRPYRTLENTIEGAVIT
FTDITEMKQARLKESEAMHRLVALVHDASDAIMFQDMEGNILAWNPKAESIYGWSEAEAL
SMNINNLIPEDRKTEEMSIVKKLSRAEVIEPYRTQRITKDSRIVDVWLTATSLVNENGEV
YAIATTEREIKLEDNEKNTK
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
ttggatgagtctccaaaaaaggactttccaattgtaggcatcggggcatcggctggtggg
ttagctgcattcgaagccttcttttcagctatgccctcagatgccgatcccggagcggct
tttgtcctgatacagcacctggatccaaattctaaaagcatcctttccgacctgatcagg
aactttactaggatgcctgtatacgaagctacaaattggataaatattgagcctaactgc
gtttacatcatcccgcctaactgcgacatggttcttcgagatggcgtgctccagttgatg
gagccatcccagccgcatggttaccgcctaccgattgatatatttttcagctctctagcc
caggacaagaaagaaaaagccatcggtatcgtcctctcgggtaccggtagtgacggcaca
aagggggtgcagactatcaaggatgagggaggaatggtaatggcacaggctcccgagtcc
agcgaatacaacaatatgcctcttagtgctattgccacaggtcaagtggattacgtcctg
aagcccgaagagatgcctgcccagctcattgcctatattacctatgtcttcggaaaaaca
cgccaggtaaccttaaaatttgaaagcctgatgaaaaatatatttaattttcttcacatc
aagactggtcatgacttttctaactacaagtatggtaccatcaatcggcgcgttgaacgg
cgcatggctgtccggaatattgataatgtgaatgagtatgtgcgttatttagagcaaaag
cctgatgaggtggaagctctctttcatgaccttttaatcggagtcaccagtttcttccgt
aatcctgaagcttatgaagcgctccagaaacgggttatcccgtgtctctttgccggcaag
tacccagagtcatcaatacgcgtctgggtgcccggatgttccacaggtgaagaggcatat
tccatagccattttacttcaggaacagatggataacttagaccaaaattttaaagtgcag
attttcgccactgatattgacagtaaggctattgaaaaggcccgtagcggcatctatcca
gccaatattgccgccgatatgtcctctaaaaggcttaagcgcttcttcacgctggattca
gacggctactaccatattcagcacaatatccgtgaaatggttattttttccgagcaggat
atcattaaggatcctccattctctaagcttgaccttatcagttgtcgcaacttgctgatc
tatatggacaaagaactgcagaagaaactaattccacttttccattatgcattgaatcct
ggtggatttctctttcttggtccctccgaaaatgtgggtgagttcacaaatctttttgac
acactggatcgcaagtcaaaactgtacataaaaaaaggcggtgctagcagtgagtatttc
ctgtccatagggacttttatctcaccatcgatgaaaagcgaagccagaaagccttcaggc
aacgttcctgtcgaaatcagacctaaactgcgcgagctgaccgagcaagcaatgctgcaa
tattacgcccctgtcagcgttctgatcgacgaacacggtaatatcctgtatatatatgga
cgtactggtatgtaccttgaaccagcttcgggtgaagttggaatgaacatattgagtatg
gcccgagaaggattaagatcaaaattgactacggccttgcacagagccgtcatagataaa
gcgccagtgtttcatcctagagtgcgagttaaaaccaacggcgatttcactacaattaat
ctggcgatacgacctgtagagcgaaaccatggtacagctacctggctaaatttgttcctg
gtcacttttgaggaaacgacggagtcagagcagatcaaaaccgaaaaggccatctccata
gatgctagcgaaaaagcctgtgataaggatttggatgtgcgaatcttaaagctgaaaaag
gagttacaggccaaggaagaaagtctcaaagcttccaatgaggaactggcgacttccaat
gaagaactcaaatctgccaacgaagagatgcagtcagtcaatgaggaactgcaatccaca
aacgaagaactggagacctcaagggaggaactgcaatcagtaaatgaggaactgggcacg
gtcaatatcgaactgcaaaacagggtagctgaactgtctcaagccaataacgacatgaat
aacctcctggctggaacaggcataggcactatctttgtggatcatcaactacgtatcatg
cgcttcactcctccagttacacgtttgataaacctgatcccatcagacattggaaggccg
gttggacatattgtctcaaaccttctgggctacgaccgcctggtagaggacataaaggag
gttctggacagcctgatacccaaagatattgaagtccagactaaggagaatacatggtat
ttactgggcatccggccttatcgcacccttgaaaacactattgaaggagcggtaatcact
tttacagatattactgagatgaaacaggcgaggcttaaggagtctgaagctatgcaccgt
ctggttgcattagtgcacgatgcgagcgatgctataatgtttcaggacatggaaggcaat
atcctggcctggaatccaaaggcagagagtatttatggctggagtgaagctgaagcactc
tcaatgaatattaacaacttgatcccagaggatcggaaaacagaagagatgtctatagtg
aaaaagcttagccgggctgaggttattgaaccttaccgcacccaaagaattaccaaagat
agtaggatagtggatgtatggctgaccgccacttcactggtaaacgaaaacggtgaagta
tatgctattgcaaccacagagcgggaaatcaaattagaagataatgagaagaacacaaaa
taa

DBGET integrated database retrieval system