KEGG   Methanosarcina barkeri: Mbar_A2224Help
Entry
Mbar_A2224        CDS       T00271                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mba  Methanosarcina barkeri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbar_A2224
   01230 Biosynthesis of amino acids
    Mbar_A2224
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2224
   00030 Pentose phosphate pathway
    Mbar_A2224
   00051 Fructose and mannose metabolism
    Mbar_A2224
  Energy metabolism
   00680 Methane metabolism
    Mbar_A2224
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbar_A2224
Enzymes [BR:mba01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mbar_A2224
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mbar_A2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2826345..2827259
Genome map
AA seq 304 aa AA seqDB search
MHMDLEKVPLDVPKTERATYLKNYMEITRESGKLMLFAGDQKVEHLNNDFYGEGIPKDDA
NPEHFFEIASKAKIGVFATQLGLIARYGMDYKNVPYLVKINSKTNLVKTSQVDPFSNLWY
DVDQVVKFKENSGLKILGVGYTVYLGSEFEAEMLMQAAQVVYNAHQHGMVSVLWLYPRGI
AVIDEKDPHLIAGATGVGACLGTDFAKVNYPEKEGANSAEAFKEAIKAAGRTKVVCAGGA
SDEVDDFLKKLHDQIHISGAMGSATGRNIHQKPLEEAIRMCNAIYAVTIEDATVEEALKI
YKGE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcatatggatctcgaaaaagtaccgttagatgtcccgaaaacagagagagcaacatac
ctgaaaaactatatggaaattactcgagaaagtgggaaattaatgctatttgcaggagac
cagaaagtagaacatttaaacaatgatttttatggggaaggaatacctaaagacgatgct
aatccagaacactttttcgaaatagcatcaaaagcaaagataggcgtttttgcaacccag
ctcgggttaattgcacgttacggtatggactacaaaaacgtgccctatcttgtgaaaata
aattcgaagactaatctcgtaaaaacttctcaggttgacccttttagcaatctctggtac
gatgtagatcaagtagtcaaatttaaagagaacagtgggctcaagatccttggagtaggt
tacactgtctatcttggcagtgaattcgaagccgagatgcttatgcaggctgcccaggta
gtttataatgcccaccagcatggaatggtctcagtactctggctctatcctcgtggcatt
gctgtaatagatgaaaaagatcctcacttaatcgctggcgcaacgggtgttggagcctgc
cttggcaccgactttgcaaaggttaactatccagaaaaggaaggagcaaactctgctgag
gcttttaaggaagctattaaagcagccgggcgtactaaagtcgtttgcgcaggcggtgcc
agtgacgaagttgatgatttcttgaaaaagcttcatgatcagatccatatctctggagca
atgggaagtgcaacaggaagaaacattcaccagaagccccttgaggaagctatccgtatg
tgtaatgctatctatgccgtaaccattgaggacgcaaccgttgaagaagctctgaaaatc
tacaaaggggaataa

DBGET integrated database retrieval system