KEGG   Methanosarcina barkeri Fusaro: Mbar_A2224Help
Entry
Mbar_A2224        CDS       T00271                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba00030  Pentose phosphate pathway
mba00051  Fructose and mannose metabolism
mba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mba00680  Methane metabolism
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01200  Carbon metabolism
mba01230  Biosynthesis of amino acids
Module
mba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2224
   00030 Pentose phosphate pathway
    Mbar_A2224
   00051 Fructose and mannose metabolism
    Mbar_A2224
  Energy metabolism
   00680 Methane metabolism
    Mbar_A2224
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbar_A2224
Enzymes [BR:mba01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mbar_A2224
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mbar_A2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AAZ71150
JGI: MbarA2224
UniProt: Q46AE2
Position
1:2826345..2827259
Genome map
AA seq 304 aa AA seqDB search
MHMDLEKVPLDVPKTERATYLKNYMEITRESGKLMLFAGDQKVEHLNNDFYGEGIPKDDA
NPEHFFEIASKAKIGVFATQLGLIARYGMDYKNVPYLVKINSKTNLVKTSQVDPFSNLWY
DVDQVVKFKENSGLKILGVGYTVYLGSEFEAEMLMQAAQVVYNAHQHGMVSVLWLYPRGI
AVIDEKDPHLIAGATGVGACLGTDFAKVNYPEKEGANSAEAFKEAIKAAGRTKVVCAGGA
SDEVDDFLKKLHDQIHISGAMGSATGRNIHQKPLEEAIRMCNAIYAVTIEDATVEEALKI
YKGE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcatatggatctcgaaaaagtaccgttagatgtcccgaaaacagagagagcaacatac
ctgaaaaactatatggaaattactcgagaaagtgggaaattaatgctatttgcaggagac
cagaaagtagaacatttaaacaatgatttttatggggaaggaatacctaaagacgatgct
aatccagaacactttttcgaaatagcatcaaaagcaaagataggcgtttttgcaacccag
ctcgggttaattgcacgttacggtatggactacaaaaacgtgccctatcttgtgaaaata
aattcgaagactaatctcgtaaaaacttctcaggttgacccttttagcaatctctggtac
gatgtagatcaagtagtcaaatttaaagagaacagtgggctcaagatccttggagtaggt
tacactgtctatcttggcagtgaattcgaagccgagatgcttatgcaggctgcccaggta
gtttataatgcccaccagcatggaatggtctcagtactctggctctatcctcgtggcatt
gctgtaatagatgaaaaagatcctcacttaatcgctggcgcaacgggtgttggagcctgc
cttggcaccgactttgcaaaggttaactatccagaaaaggaaggagcaaactctgctgag
gcttttaaggaagctattaaagcagccgggcgtactaaagtcgtttgcgcaggcggtgcc
agtgacgaagttgatgatttcttgaaaaagcttcatgatcagatccatatctctggagca
atgggaagtgcaacaggaagaaacattcaccagaagccccttgaggaagctatccgtatg
tgtaatgctatctatgccgtaaccattgaggacgcaaccgttgaagaagctctgaaaatc
tacaaaggggaataa

DBGET integrated database retrieval system